Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.07
PubTator Score 12.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.100 7.6e-03
ependymoma 1.600 9.1e-03
oligodendroglioma 1.800 3.3e-03
group 4 medulloblastoma 1.400 4.3e-04
medulloblastoma, large-cell 1.100 6.1e-03
subependymal giant cell astrocytoma -1.043 1.9e-02
Gaucher disease type 1 -1.500 2.8e-02

Gene RIF (7)

PMID Text
25378556 hnRNP-U inhibits TDP-43-mediated alterations in splicing of POLDIP3 mRNA.
25049393 these findings establish critical and essential roles for SKAR in the regulation of mRNA translation of IFN-sensitive genes and induction of IFN-alpha biological responses.
22928037 PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
22900096 Alteration of POLDIP3 splicing associated with loss of function of TDP-43 in tissues affected with amyotrophic lateral sclerosis (ALS) .
18423201 SKAR-mediated recruitment of activated S6K1 to newly processed mRNPs serves as a conduit between mTOR checkpoint signaling and the pioneer round of translation when cells exist in conditions supportive of protein synthesis.
16984396 This study showed that PDIP46 aka SKAR, a protein possessing one RNA recognition motif (RRM) and being a protein partner of both the p50 subunit of DNA polymerase delta and p70 ribosomal protein S6 kinase 1 (S6K1).
15341740 SKAR is a specific target of S6K1 and regulates cell growth.

AA Sequence

MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLG      1 - 70
VKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVT     71 - 140
PALKLTKTIQVPQQKAMAPLHPHPAGMRINVVNNHQAKQNLYDLDEDDDGIASVPTKQMKFAASGGFLHH    141 - 210
MAGLSSSKLSMSKALPLTKVVQNDAYTAPALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGT    211 - 280
KMTVNNLHPRVTEEDIVELFCVCGALKRARLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHM    281 - 350
NGNVITSDQPILLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIK    351 - 420
L//

Text Mined References (33)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25378556 2015 Nuclear TDP-43 causes neuronal toxicity by escaping from the inhibitory regulation by hnRNPs.
25049393 2014 Regulatory effects of SKAR in interferon ? signaling and its role in the generation of type I IFN responses.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928037 2012 The proteins PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
22900096 2012 Alteration of POLDIP3 splicing associated with loss of function of TDP-43 in tissues affected with ALS.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22121224 2012 TDP-43 regulates global translational yield by splicing of exon junction complex component SKAR.
21269460 2011 Initial characterization of the human central proteome.
20844015 2010 ATP is required for interactions between UAP56 and two conserved mRNA export proteins, Aly and CIP29, to assemble the TREX complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18423201 2008 SKAR links pre-mRNA splicing to mTOR/S6K1-mediated enhanced translation efficiency of spliced mRNAs.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16984396 2006 Human enhancer of rudimentary is a molecular partner of PDIP46/SKAR, a protein interacting with DNA polymerase delta and S6K1 and regulating cell growth.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15341740 2004 SKAR is a specific target of S6 kinase 1 in cell growth control.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12522211 2003 Identification of a novel protein, PDIP38, that interacts with the p50 subunit of DNA polymerase delta and proliferating cell nuclear antigen.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11258795 2001 Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping.
10591208 1999 The DNA sequence of human chromosome 22.