Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 11.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.200 2.3e-02
osteosarcoma -1.120 1.8e-04
ovarian cancer 1.300 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.295 2.8e-03

Gene RIF (11)

AA Sequence

MAACTARRALAVGSRWWSRSLTGARWPRPLCAAAGAGAFSPASTTTTRRHLSSRNRPEGKVLETVGVFEV      1 - 70
PKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDA     71 - 140
RDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPP    141 - 210
FVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLR    211 - 280
ERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP    281 - 350
FSLESNKDEKTPPSGLHW                                                        351 - 368
//

Text Mined References (29)

PMID Year Title