Property Summary

Ligand Count 6
NCBI Gene PubMed Count 187
PubMed Score 415.20
PubTator Score 804.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
diabetes mellitus -1.200 5.0e-03
gastric cancer -1.100 4.7e-03
glioblastoma -1.100 7.1e-03
hepatocellular carcinoma -1.800 7.0e-06
invasive ductal carcinoma 1.200 3.6e-02
ovarian cancer 1.500 1.6e-03
pancreatic cancer -1.400 2.4e-03
pancreatic carcinoma -1.400 2.4e-03
psoriasis 1.100 8.3e-03
subependymal giant cell astrocytoma -1.597 1.5e-02

PDB (309)

Gene RIF (155)

AA Sequence

MSKRKAPQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIA      1 - 70
EKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGL     71 - 140
KYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESTKQPKL    141 - 210
LHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNK    211 - 280
NMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE                   281 - 335
//

Text Mined References (190)

PMID Year Title