Property Summary

NCBI Gene PubMed Count 22
PubMed Score 32.67
PubTator Score 18.88

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (11)

PMID Text
27003260 High expression of POFUT1 correlates with aggressive clinicopathological characteristics and poor prognosis of hepatocellular carcinoma patients.
25229252 Identification of six pathogenic POFUT1 mutations in Dowling-Degos disease patients of different ethnic origin.
25165882 The upregulation of poFUT1 by LIF facilitated trophoblast cell migration and invasion through activating the PI3K/Akt signaling pathway.
25157627 Only a novel 1-bp deletion (c.246+5delG) in POFUT1 was found in a Chinese family with Dowling-Degos disease (DDD). No other novel mutation or this deletion was detected in POFUT1 in a second DDD family and a sporadic DDD case by Sanger Sequencing.
25107841 Silencing of Pofut1 expression exerted antiproliferative and antiadhesive effects on hepatocytes.
24064921 POFUT1 expression can contribute to cancer progression and that POFUT1 may serve as a diagnostic marker and a therapeutic target for OSCCs.
23684010 The protein product of POFUT1 plays a significant and conserved role in melanin synthesis and transport.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides upregulate gene expression of protein O-fucosyltransferase 1 (POFUT1) in U-937 macrophages
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18347015 Pofut1 and O-fucose have roles in mammalian Notch signaling
15653671 fucosyltransferases, O-FucT-1 is a soluble protein that localizes to the endoplasmic reticulum and recognizes properly folded epidermal growth factor-like repeats.

AA Sequence

MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW      1 - 70
IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC     71 - 140
PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK    141 - 210
YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM    211 - 280
TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF    281 - 350
IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF                                    351 - 388
//

Text Mined References (27)

PMID Year Title
27003260 2016 Overexpression of protein O-fucosyltransferase 1 accelerates hepatocellular carcinoma progression via the Notch signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25229252 2015 Pathogenicity of POFUT1 in Dowling-Degos disease: additional mutations and clinical overlap with reticulate acropigmentation of kitamura.
25165882 2014 LIF upregulates poFUT1 expression and promotes trophoblast cell migration and invasion at the fetal-maternal interface.
25157627 2014 Analysis of POFUT1 gene mutation in a Chinese family with Dowling-Degos disease.
25107841 2014 Downregulated protein O-fucosyl transferase 1 (Pofut1) expression exerts antiproliferative and antiadhesive effects on hepatocytes by inhibiting Notch signalling.
24064921 2013 Protein O-fucosyltransferase 1: a potential diagnostic marker and therapeutic target for human oral cancer.
23684010 2013 Mutations in POFUT1, encoding protein O-fucosyltransferase 1, cause generalized Dowling-Degos disease.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18347015 2008 Roles of Pofut1 and O-fucose in mammalian Notch signaling.
15653671 2005 O-fucosylation of notch occurs in the endoplasmic reticulum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12697902 2003 Protein O-fucosyltransferase 1 is an essential component of Notch signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12036964 2002 Notch ligands are substrates for protein O-fucosyltransferase-1 and Fringe.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
11524432 2001 Modification of epidermal growth factor-like repeats with O-fucose. Molecular cloning and expression of a novel GDP-fucose protein O-fucosyltransferase.
9525914 1998 Purification and characterization of a GDP-fucose:polypeptide fucosyltransferase from Chinese hamster ovary cells.
9023546 1996 Identification of a GDP-L-fucose:polypeptide fucosyltransferase and enzymatic addition of O-linked fucose to EGF domains.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.
8358148 1993 O-linked fucose and other post-translational modifications unique to EGF modules.