Property Summary

NCBI Gene PubMed Count 72
PubMed Score 241.52
PubTator Score 171.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 5.300 5.2e-10
esophageal adenocarcinoma 1.100 2.3e-02
psoriasis -1.200 8.0e-07
cystic fibrosis 2.269 9.4e-07
glioblastoma 1.500 1.6e-02
pancreatic ductal adenocarcinoma liver m... 1.305 1.7e-02
non-small cell lung cancer -1.359 3.2e-14
intraductal papillary-mucinous adenoma (... -1.800 8.9e-06
intraductal papillary-mucinous carcinoma... -1.300 3.5e-03
colon cancer 1.700 3.3e-08
active Crohn's disease 1.726 1.4e-03
ulcerative colitis 1.500 1.3e-06
breast carcinoma -1.100 1.7e-03
group 3 medulloblastoma 1.400 3.1e-03
pilocytic astrocytoma 1.200 6.1e-06
lung adenocarcinoma -1.900 5.2e-15
Breast cancer -1.700 2.3e-08
ovarian cancer -2.600 4.0e-07
dermatomyositis 1.200 5.4e-03

Protein-protein Interaction (4)

Gene RIF (50)

PMID Text
26674770 In gastric cancer, PODXL expression by the polyclonal antibody HPA2110 is an independent marker of poor prognosis.
26329844 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level.
26276714 PCLP1 expressed on breast tumor cells may function as an immunomodulatory molecule, which may represent a mechanism to evade the immune response.
26135398 EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness
26053486 podocalyxin to be an independent factor for poor prognosis in PDAC. To our knowledge, this is the first such report of its prognostic value.
26017117 PCX promotes cisplatin chemoresistance in osteosarcoma cells through a PI3Kdependent mechanism.
25915207 PODXL up-regulates the expression level of Bmi1 in OTSCC cells.
25905599 Obese subjects showed evidence of renal alteration through the detection of a higher number of urinary podocalyxin positive cells.
25887862 We show that podocalyxin plays a key role in the formation of primary tumors and distant tumor metastasis.
25738314 miR-125b was found to be important in arteriosclerosis obliterans by suppressing the expression of PODXL and may serve as a potential therapeutic target for the treatment of arteriosclerosis obliterans.
24970760 These findings show that overexpression of PODXL enhanced invadopodia formation and tumor metastasis by inducing Rac1/Cdc42/cortactin signaling network.
24821609 overexpression of PODXL may be associated with human oral squamous cell carcinoma aggressiveness
24146797 PODXL is expressed in glioblastoma multiforme stem-like cells and is involved in cell proliferation and oncosphere formation.
24143384 TRA-1-81 is expressed only in the cytoplasm of uterine smooth muscle neoplasms.
24075693 Urinary Podocalyxin positive-element may be a noninvasive marker for the early stage of Diabetic nephropathy.
24048372 A variant form of PODXL remains the most likely candidate causing focal and segmental glomerulosclerosis in a family with autosomal dominant inheritance.
23819542 Suggest that analysis of PODXL expression in the primary tumour is sufficient for its use as a prognostic and treatment predictive biomarker in colorectal cancer, also in patients with metastatic disease.
23652315 Membranous PODXL expression is an independent risk factor for progressive disease and death in patients with urothelial bladder cancer
23526252 podocalyxin, a heavily glycosylated type 1 transmembrane protein, is a glycoprotein ligand of recombinant N-terminal domain of the lectin BC2L-C from Burkholderia cenocepacia on human induced pluripotent stem cells and embryonic stem cells.
23396057 The results obtained indicate that integrity of the PODXL ectodomain is essential for enhancing cell adhesion but not migration, while the integrity of the cytoplasmic domain is required for both adhesion and migration.
23288345 PODXL has the potential to be a useful biomarker for identifying good prognosis patients in characteristically poor prognosis breast cancer groups and may impact treatment of women with this disease.
22814396 Sialofucosylated PODXL is a functional E-and L-selectin ligand expressed by metastatic pancreatic cancer cells.
22769594 PODXL protein expression was analyzed n tissue microarrays with colorectal cancer tumor samples. High PODXL protein expression was significantly associated with unfavourable clinicopathological characteristics in both cohorts.
22700887 Levels of urinary PCX and the number of urinary podocytes are associated with histologic abnormalities in adults with IgA nephropathy.
22374871 Most AML patients had a significant decrease in miR-199b-5p levels with elevated PODXL & DDR1 expressions. Both PODXL & DDR1 are targets of miR-199b-5p.
22262060 podocalyxin's ability to facilitate the formation of non-adhesive membrane domains may contribute to the formation of free-floating high grade serous tumor nodules during the initial steps of transperitoneal metastasis.
21829192 Podocalyxin-like 1 expression is an independent factor of poor prognosis in colorectal carcinoma.
21655212 The urinary mRNA profiles of synaptopodin, podocalyxin, CD2-AP, alpha-actin4, and podocin were found to increase with the progression of diabetic nephropathy.
21616097 intact PODXL is released to the extracellular space as a cargo of microvesicles and also as a soluble cleaved fragment of ectodomain
21390327 PINCH1 is transcriptional regulator in podocytes that interacts with WT1 and represses podocalyxin expression.
21383689 This report identifies DNA methylation, miR-199a dysregulation and PODXL as critical factors in tumor malignancy.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20599725 In pluripotent stem cells and in human cancer disease, podocalyxin may function in part to regulate and maintain the cell surface expression of the glucose-3-transporter.
20395446 Data show that podocalyxin overexpression in human embryonic kidney cells up-regulates Rac1 activity, which depends on a complex formed by podocalyxin, ERM-binding phosphoprotein 50, ezrin, and ARHGEF7, a Rac1 activator.
19605546 Impaired WT1/Cre-binding protein interplay in addition to advanced glycation end products suppress podocalyxin expression in high glucose-treated human podocytes.
19118161 Podocalyxin-like protein is an E-/L-selectin ligand on colon carcinoma cells: comparative biochemical properties of selectin ligands in host and tumor cells.
18818395 PODXL(hi)/CD49f(hi) MSCs were less prone to produce lethal pulmonary emboli
18456258 Results suggest that human podocalyxin enhances the adherence of cells to immobilized ligands and to vascular endothelial cells through a mechanism(s) dependent on the activity of integrins.
18356574 A monoclonal antibody-antigen complex reveals the presence podocalyxin-like protein-1 in undifferentiated embryonic stem cells.
18313397 Our results suggest that aggregated distribution of TRA-1-81 antigen is characteristic for undifferentiated hES cells.
17719804 A 2315-Da peptide found only in medium from SFC colon cancer cell lines was identified and shown to consist of a portion of both the extracellular and transmembrane regions of human podocalyxin-like 1.
17616675 podocalyxin leads to increased in vitro migration and invasion, increased MMP expression, and increased activation of MAPK and PI3K activity in MCF7 and PC3 cells through its ability to form a complex with ezrin
17311105 Podocalyxin defines apical membrane domains and is a potent inducer of microvillus formation
17137615 44% of pancreatic ductal adenocarcinomas expressed PODXL-1 in a membranous pattern, and there was no expression in intrahepatic cholangiocarcinomas, rarely in adenocarcinomas of the extrahepatic bile ducts, and none in duodenal adenocarcinomas.
17124010 Embryonal carcinoma expresses two distinct forms of podocalyxin, and the larger version is a molecular carrier of the human stem cell-defining antigens TRA-1-60 and TRA-1-81. [TRA-1-60 AND TRA-1-81 AND podocalyxin]
16684343 Transcriptional regulation of Podxl is supported primarily by Sp1 site(s) and that DNA-methylation of the CpG promoter islands contributes to control the tissue specific expression of podxl.
16434482 Observational study of gene-disease association. (HuGE Navigator)
16434482 PODXL variants are implicated in prostate neoplasm aggressiveness, with gene mapping to chromosome 7q32-q33.
15289306 Overexpression of the anti-adhesin podocalyxin is associated with breast cancer progression
15226400 podocalyxin has a role in defining the structure of the podocyte basal surface

AA Sequence

MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSK      1 - 70
ANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTAT     71 - 140
AKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLM    141 - 210
KISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTS    211 - 280
SQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ    281 - 350
TQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP    351 - 420
AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQR    421 - 490
KDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL      491 - 558
//

Text Mined References (79)

PMID Year Title
26674770 2015 Podocalyxin as a Prognostic Marker in Gastric Cancer.
26329844 2015 Distinct kinetic and mechanical properties govern mucin 16- and podocalyxin-mediated tumor cell adhesion to E- and L-selectin in shear flow.
26276714 2015 Podocalyxin-like protein 1 functions as an immunomodulatory molecule in breast cancer cells.
26135398 2015 Co-Expression of Ezrin-CLIC5-Podocalyxin Is Associated with Migration and Invasiveness in Hepatocellular Carcinoma.
26053486 2015 Podocalyxin Is a Marker of Poor Prognosis in Pancreatic Ductal Adenocarcinoma.
26017117 2015 Podocalyxin promotes cisplatin chemoresistance in osteosarcoma cells through phosphatidylinositide 3-kinase signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915207 2015 Bmi1 essentially mediates podocalyxin-enhanced Cisplatin chemoresistance in oral tongue squamous cell carcinoma.
25905599 2016 Urinary podocalyxin, the novel biomarker for detecting early renal change in obesity.
25887862 2015 Podocalyxin enhances breast tumor growth and metastasis and is a target for monoclonal antibody therapy.
25738314 2015 MicroRNA-125b is involved in atherosclerosis obliterans in vitro by targeting podocalyxin.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24970760 2014 Podocalyxin-like 1 promotes invadopodia formation and metastasis through activation of Rac1/Cdc42/cortactin signaling in breast cancer cells.
24821609 2014 Podocalyxin-like 1 is associated with tumor aggressiveness and metastatic gene expression in human oral squamous cell carcinoma.
24146797 2013 Podocalyxin-like protein is expressed in glioblastoma multiforme stem-like cells and is associated with poor outcome.
24143384 2013 Expression and intracellular localization of ACA and TRA-1-81 in smooth muscle cell tumors.
24075693 Urinary podocalyxin positive-element occurs in the early stage of diabetic nephropathy and is correlated with a clinical diagnosis of diabetic nephropathy.
24048372 2014 Exome sequencing and in vitro studies identified podocalyxin as a candidate gene for focal and segmental glomerulosclerosis.
23819542 2013 Podocalyxin-like protein expression in primary colorectal cancer and synchronous lymph node metastases.
23652315 2013 Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23526252 2013 Podocalyxin is a glycoprotein ligand of the human pluripotent stem cell-specific probe rBC2LCN.
23396057 2013 Control of cell adhesion and migration by podocalyxin. Implication of Rac1 and Cdc42.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23288345 2013 Elevated expression of podocalyxin is associated with lymphatic invasion, basal-like phenotype, and clinical outcome in axillary lymph node-negative breast cancer.
22814396 2012 Sialofucosylated podocalyxin is a functional E- and L-selectin ligand expressed by metastatic pancreatic cancer cells.
22769594 2012 Validation of podocalyxin-like protein as a biomarker of poor prognosis in colorectal cancer.
22700887 2012 Relationships between levels of urinary podocalyxin, number of urinary podocytes, and histologic injury in adult patients with IgA nephropathy.
22662192 2012 IQGAP1 interacts with components of the slit diaphragm complex in podocytes and is involved in podocyte migration and permeability in vitro.
22374871 2012 miR-199b-5p directly targets PODXL and DDR1 and decreased levels of miR-199b-5p correlate with elevated expressions of PODXL and DDR1 in acute myeloid leukemia.
22262060 2012 The anti-adhesive mucin podocalyxin may help initiate the transperitoneal metastasis of high grade serous ovarian carcinoma.
21829192 2011 Overexpression of podocalyxin-like protein is an independent factor of poor prognosis in colorectal cancer.
21655212 2011 Urinary podocyte-associated mRNA profile in various stages of diabetic nephropathy.
21616097 2011 Release of podocalyxin into the extracellular space. Role of metalloproteinases.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21390327 2011 PINCH1 is transcriptional regulator in podocytes that interacts with WT1 and represses podocalyxin expression.
21383689 2011 Methylation of an intronic region regulates miR-199a in testicular tumor malignancy.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20599725 2010 The human cancer and stem cell marker podocalyxin interacts with the glucose-3-transporter in malignant pluripotent stem cells.
20395446 2010 Podocalyxin EBP50 ezrin molecular complex enhances the metastatic potential of renal cell carcinoma through recruiting Rac1 guanine nucleotide exchange factor ARHGEF7.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19605546 2009 Impaired transcription factor interplay in addition to advanced glycation end products suppress podocalyxin expression in high glucose-treated human podocytes.
19118161 2009 Podocalyxin-like protein is an E-/L-selectin ligand on colon carcinoma cells: comparative biochemical properties of selectin ligands in host and tumor cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18818395 2009 The CD34-like protein PODXL and alpha6-integrin (CD49f) identify early progenitor MSCs with increased clonogenicity and migration to infarcted heart in mice.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18456258 2008 Expression of podocalyxin enhances the adherence, migration, and intercellular communication of cells.
18356574 2008 Selection against undifferentiated human embryonic stem cells by a cytotoxic antibody recognizing podocalyxin-like protein-1.
18313397 2008 Profiling TRA-1-81 antigen distribution on a human embryonic stem cell.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17719804 2007 Extracellular and transmembrane region of a podocalyxin-like protein 1 fragment identified from colon cancer cell lines.
17616675 2007 Podocalyxin increases the aggressive phenotype of breast and prostate cancer cells in vitro through its interaction with ezrin.
17311105 2007 The CD34-related molecule podocalyxin is a potent inducer of microvillus formation.
17137615 2007 Podocalyxin-like protein 1 expression is useful to differentiate pancreatic ductal adenocarcinomas from adenocarcinomas of the biliary and gastrointestinal tracts.
17124010 2007 The TRA-1-60 and TRA-1-81 human pluripotent stem cell markers are expressed on podocalyxin in embryonal carcinoma.
16684343 2006 Role of transcription factor Sp1 and CpG methylation on the regulation of the human podocalyxin gene promoter.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16434482 2006 Podocalyxin variants and risk of prostate cancer and tumor aggressiveness.
15642748 2005 Gp135/podocalyxin and NHERF-2 participate in the formation of a preapical domain during polarization of MDCK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15326289 2004 Identification and proteomic profiling of exosomes in human urine.
15289306 2004 Overexpression of the anti-adhesin podocalyxin is an independent predictor of breast cancer progression.
15226400 2004 Enhanced podocalyxin expression alters the structure of podocyte basal surface.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874460 2003 Expression of podocyte-associated molecules in acquired human kidney diseases.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12504081 2003 Human embryonal carcinoma tumor antigen, Gp200/GCTM-2, is podocalyxin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997330 2002 PDZ domain-mediated interaction of rabbit podocalyxin and Na(+)/H(+) exchange regulatory factor-2.
11457882 2001 Loss of glomerular foot processes is associated with uncoupling of podocalyxin from the actin cytoskeleton.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9625756 1998 Identification of podocalyxin-like protein as a high endothelial venule ligand for L-selectin: parallels to CD34.
9339384 1997 Assignment of the human podocalyxin-like protein (PODXL) gene to 7q32-q33.
9188463 1997 Molecular cloning and characterization of human podocalyxin-like protein. Orthologous relationship to rabbit PCLP1 and rat podocalyxin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.