Property Summary

NCBI Gene PubMed Count 10
PubMed Score 56.94
PubTator Score 11.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis -1.037 1.6e-03
primary pancreatic ductal adenocarcinoma 1.150 3.7e-03
intraductal papillary-mucinous carcinoma... -1.200 1.6e-04
intraductal papillary-mucinous neoplasm ... -1.300 1.6e-03
lung carcinoma -1.600 1.8e-15
ductal carcinoma in situ -1.500 1.6e-02
invasive ductal carcinoma -1.800 1.9e-02
ovarian cancer -2.100 9.1e-20
pancreatic cancer 1.300 1.8e-03
psoriasis -1.100 4.8e-22

Gene RIF (4)

PMID Text
24043300 Podocan appears to be a potent negative regulator of the migration and proliferation of vascular smooth muscle cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15063725 PODN was characterized in cultured cells.

AA Sequence

MAQSRVLLLLLLLPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPR      1 - 70
DCACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEK     71 - 140
AFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPNLRSVYLHNNKLADAGLPD    141 - 210
NMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEKIPPGAFSELSSLRELYLQNNYLTDEGLD    211 - 280
NETFWKLSSLEYLDLSSNNLSRVPAGLPRSLVLLHLEKNAIRSVDANVLTPIRSLEYLLLHSNQLREQGI    281 - 350
HPLAFQGLKRLHTVHLYNNALERVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQ    351 - 420
VHRDAFRKLRLLRSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSR    421 - 490
ALGPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAV    491 - 560
GSVVDSAFRRLKHLQVLDIEGNLEFGDISKDRGRLGKEKEEEEEEEEEEEETR                     561 - 613
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043300 2013 Novel small leucine-rich repeat protein podocan is a negative regulator of migration and proliferation of smooth muscle cells, modulates neointima formation, and is expressed in human atheroma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15063725 2004 Functional characterization of podocan, a member of a new class in the small leucine-rich repeat protein family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12796502 2003 Podocan, a novel small leucine-rich repeat protein expressed in the sclerotic glomerular lesion of experimental HIV-associated nephropathy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.