Property Summary

NCBI Gene PubMed Count 41
PubMed Score 233.01
PubTator Score 102.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.266 9.6e-03
juvenile dermatomyositis 1.555 4.0e-11
non-small cell lung cancer 1.355 5.0e-21
Breast cancer 2.900 2.5e-02
nasopharyngeal carcinoma 1.200 3.1e-04
Pick disease -1.300 4.6e-05
progressive supranuclear palsy -1.500 4.9e-03
invasive ductal carcinoma 1.200 5.8e-04
ovarian cancer 2.200 1.7e-05

Gene RIF (28)

PMID Text
24729470 this study provides further evidence that hPNPase(old-35) is associated with global changes in cell cycle-associated genes and identifies potential gene targets for future investigation
24143183 fresh insight into cellular pathways regulated by PNPT1
23221631 Interaction between PNPase and hSuv3 is essential for efficient mitochondrial RNA degradation.
23084291 Mutation in PNPT1, which encodes a polyribonucleotide nucleotidyltransferase, impairs RNA import into mitochondria and causes respiratory-chain deficiency.
23084290 A mutation in PNPT1, encoding mitochondrial-RNA-import protein PNPase, causes hereditary hearing loss.
22815474 a novel role of nEGFR in radioresistance, and that is, upon ionizing radiation, nEGFR inactivates the ribonuclease activity of PNPase toward c-MYC mRNA through DNAPK-mediated Ser-776 phosphorylation
22210891 The study provides structural and functional insights into hPNPase, which uses a KH pore to trap a long RNA 3' tail that is further delivered into an RNase PH channel for the degradation process.
21151174 targeted overexpression of hPNPase(old-35) represents a novel strategy to selectively downregulate RNA expression and consequently intervene in a variety of pathophysiological conditions
20877624 Observational study of gene-disease association. (HuGE Navigator)
20691904 The data support an unanticipated role for PNPASE in mediating the translocation of RNAs into mitochondria.
20547861 Inhibition of PNPase by shRNA or stable overexpression of miR-221 protected melanoma cells from IFN-beta-mediated growth inhibition, accentuating the importance of PNPase induction and miR-221 down-regulation in mediating IFN-beta action.
20546612 Observational study of gene-disease association. (HuGE Navigator)
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19580345 maintained expression and even up-regulation of some (PNPT1, PMPCB, HMMR/RHAMM, BSG and ERCC1) tumor associated antigens in CD40-activated leukemic cells.
19509288 The complex of hSUV3-hPNPase is an integral entity for efficient degradation of structured RNA and may be the long sought RNA-degrading complex in the mammalian mitochondria.
18083837 Involvement of human polynucleotide phosphorylase in mtRNA degradation was studied.
18083836 In this work, the degradation, polymerization, and RNA-binding properties of the human PNPase were analyzed and compared to its bacterial and organellar counterparts.
17983748 recent advances in understanding the various roles of hPNPase both within and potentially outside of the mitochondria [review]
17804700 A novel pathway by which an evolutionary conserved RNA-metabolizing enzyme, hPNPase(old-35), regulates cell growth and viability.
16966381 Combined, the data demonstrate an unexpected IMS localization and a key role for PNPase in maintaining mitochondrial homeostasis.
16966379 PNPase localization to the mitochondrial intermembrane space suggests a unique role distinct from its highly conserved function in RNA processing in chloroplasts and bacteria.
16505900 human PNPase mRNA upregulation by beta-interferon has no effect on protein level in melanoma cell lines
16410805 Targeted overexpression of hPNPase(old-35) might be a novel therapeutic strategy for c-myc-overexpressing and IFN-resistant tumors, such as melanomas.
16055741 analysis of domains of human polynucleotide phosphorylase (hPNPaseOLD-35) mediating cellular senescence
12798676 demonstrate that the hPNPase is localized in mitochondria; finding suggests the involvement of mitochondrial RNA metabolism in cellular senescence
12721301 the molecular mechanism of the growth-arresting property of hPNPaseold-35
12473748 an important role for hPNPase(old-35)in growth control associated with terminal differentiation and cellular senescence.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring

AA Sequence

MAACRYCCSCLRLRPLSDGPFLLPRRDRALTQLQVRALWSSAGSRAVAVDLGNRKLEISSGKLARFADGS      1 - 70
AVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRREIGTSDKEILTSRIIDRSIRP     71 - 140
LFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVRIGIIDGEYVVNPTRKEMS    141 - 210
SSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPS    211 - 280
PEIVKYTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRS    281 - 350
IVLNEYKRCDGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKD    351 - 420
KNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACG    421 - 490
GSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQAD    491 - 560
IKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRASRKENGPVVETVQVPLSKRAKFVGPGGYNLKK    561 - 630
LQAETGVTISQVDEETFSVFAPTPSAMHEARDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYP    631 - 700
NMTAVLLHNTQLDQRKIKHPTALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRSSIV    701 - 770
MGEPISQSSSNSQ                                                             771 - 783
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24729470 2014 Analysis of global changes in gene expression induced by human polynucleotide phosphorylase (hPNPase(old-35)).
24143183 2013 Identification of genes potentially regulated by human polynucleotide phosphorylase (hPNPase old-35) using melanoma as a model.
23221631 2013 Human mitochondrial RNA decay mediated by PNPase-hSuv3 complex takes place in distinct foci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084291 2012 Mutation in PNPT1, which encodes a polyribonucleotide nucleotidyltransferase, impairs RNA import into mitochondria and causes respiratory-chain deficiency.
23084290 2012 A mutation in PNPT1, encoding mitochondrial-RNA-import protein PNPase, causes hereditary hearing loss.
22815474 2012 Nuclear EGFR suppresses ribonuclease activity of polynucleotide phosphorylase through DNAPK-mediated phosphorylation at serine 776.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22210891 2012 Crystal structure of human polynucleotide phosphorylase: insights into its domain function in RNA binding and degradation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21151174 2011 Human polynucleotide phosphorylase (hPNPase(old-35)): an evolutionary conserved gene with an expanding repertoire of RNA degradation functions.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20691904 2010 PNPASE regulates RNA import into mitochondria.
20547861 2010 Human polynucleotide phosphorylase selectively and preferentially degrades microRNA-221 in human melanoma cells.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19864255 2010 Human mitochondrial RNA turnover caught in flagranti: involvement of hSuv3p helicase in RNA surveillance.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19580345 2009 Acute lymphoblastic leukemia-derived dendritic cells express tumor associated antigens: PNPT1, PMPCB, RHAMM, BSG and ERCC1.
19509288 2009 Human mitochondrial SUV3 and polynucleotide phosphorylase form a 330-kDa heteropentamer to cooperatively degrade double-stranded RNA with a 3'-to-5' directionality.
18501193 2008 Human polynucleotide phosphorylase reduces oxidative RNA damage and protects HeLa cell against oxidative stress.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18083837 2008 Stable PNPase RNAi silencing: its effect on the processing and adenylation of human mitochondrial RNA.
18083836 2008 Analysis of the human polynucleotide phosphorylase (PNPase) reveals differences in RNA binding and response to phosphate compared to its bacterial and chloroplast counterparts.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17983748 2007 Human polynucleotide phosphorylase: location matters.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17804700 2007 Activation of double-stranded RNA dependent protein kinase, a new pathway by which human polynucleotide phosphorylase (hPNPase(old-35)) induces apoptosis.
16966381 2006 Mammalian polynucleotide phosphorylase is an intermembrane space RNase that maintains mitochondrial homeostasis.
16966379 2006 A new function in translocation for the mitochondrial i-AAA protease Yme1: import of polynucleotide phosphorylase into the intermembrane space.
16934922 2007 The TCL1 oncoprotein binds the RNase PH domains of the PNPase exoribonuclease without affecting its RNA degrading activity.
16505900 2006 Up-regulation of human PNPase mRNA by beta-interferon has no effect on protein level in melanoma cell lines.
16410805 2006 Defining the mechanism by which IFN-beta dowregulates c-myc expression in human melanoma cells: pivotal role for human polynucleotide phosphorylase (hPNPaseold-35).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16055741 2005 Defining the domains of human polynucleotide phosphorylase (hPNPaseOLD-35) mediating cellular senescence.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14563561 2003 Expression regulation and genomic organization of human polynucleotide phosphorylase, hPNPase(old-35), a Type I interferon inducible early response gene.
12798676 2003 Human polynucleotide phosphorylase, hPNPase, is localized in mitochondria.
12721301 2003 Down-regulation of Myc as a potential target for growth arrest induced by human polynucleotide phosphorylase (hPNPaseold-35) in human melanoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473748 2002 Identification and cloning of human polynucleotide phosphorylase, hPNPase old-35, in the context of terminal differentiation and cellular senescence.
12419256 2002 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.