Property Summary

NCBI Gene PubMed Count 199
PubMed Score 329.54
PubTator Score 359.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.200 3.0e-06
osteosarcoma 2.252 1.4e-05
Atopic dermatitis -1.400 5.3e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-03
group 3 medulloblastoma 1.600 1.1e-04
psoriasis -1.400 3.1e-41
Breast cancer 1.800 3.8e-03
ovarian cancer -1.700 1.1e-05

Protein-protein Interaction (8)

Gene RIF (208)

PMID Text
27015186 The PPARGC1A rs8192678 GA/AA genotype and the PNPLA3 rs738409 GG genotype had an additive effect on NASH in severely obese Taiwanese patients.
26847197 This study investigates the association between PNPLA3 rs738409 with health services utilization in a general population. PNPLA3 rs738409 was associated with the number of outpatient visits, hospitalization, and inpatient days.
26760234 PNPLA3 rs738409 polymorphism was associated with the severity of liver fibrosis in patients coinfected with HIV and hepatitis C virus.
26745555 The PNPLA3 p.I148M variant is associated with non-alcoholic fatty liver disease.
26745088 PNPLA3 polymorphism is associated with Hepatocellular Carcinoma Development in Non-Viral Chronic Liver Diseases.
26707313 The rs2629751 genotype may be an important predictor of posttransplant outcome in HCV-infected patients.
26632699 Meta-analysis indicates that I148M polymorphism in the ADPN gene may independently contribute to the progression of Hepatocellular Carcinoma irrespective of the etiologies.
26605757 rs2294918 E434K decreased PNPLA3 expression, lessening the effect of the I148M variant on predisposition to steatosis and liver damage
26599080 analysis of PNPLA3 (rs738409) and IL28B (rs12979860) SNPs in HIV/HCV coinfected patients reveals no impact on liver disease or treatment response
26519102 As the HepG2 cell line harbors the I148M mutation in homozygous state it is hypothesized that this should represent an ideal model system for PNPLA3 biology.
26493626 transmembrane 6 superfamily 2 C/T or T/T variants in conjunction with patatin-like phospho-lipase domain-containing protein 3 G/G variants may be potential genetic risk factors for developing HCC in alcohol-related cirrhosis.
26485523 Data show that the G allele of PNPLA3 protein single nucleotide polymorphism rs738409 and weight gain had a joint effect on the risk of non-alcoholic fatty liver disease (NAFLD) in the normal weight and the overweight individuals.
26482880 rs738409 in PNPLA3 is an important risk locus for alcohol-related cirrhosis.
26439088 PNPLA3 I148M variant is relevant for the retinyl-palmitate content in human liver, providing a possible link to chronic liver disease
26379412 Letter: PNPLA3 I148M affects de novo NAFLD occurrence with a prominent interaction with obesity in liver transplant recipients.
26355465 PNPLA3 148M Carriers with Inflammatory Bowel Diseases Have Higher Susceptibility to Hepatic Steatosis and Higher Liver Enzymes.
26352693 IL28B and PNPLA3 genotypes are associated with rapid fibrosis progression, and the progression rate -score identifies patients who has a high risk of fibrosis progression and require urgent antiviral treatment
26305067 based on data from the HALT-C trial, the PNPLA3 CG/GG SNP at rs738409 is associated with fibrosis progression but not development of Hepatocellular Carcinoma in patients with Hepatitis C Virus Infection
26272871 Treating liver fat and serum triglyceride levels in NAFLD, effects of PNPLA3 and TM6SF2 genotypes: effect of Omacor administration.
26259026 Steatosis severity was independently associated with PNPLA3 rs738409 in large cohort of patients with genotype 1 Chronic hepatitis C.
26229402 Four linked SNPs of PNPLA3 (rs738409, rs3747206, rs4823173, and rs2072906) are correlated with susceptibility to NAFLD, NASH, liver fibrosis, and HBV dynamics in chronic hepatitis B patients.
26200108 Study shows that the PNPLA3 rs738409 genotypes are associated with the risk of non-alcoholic fatty liver disease and decline of the estimated glomerular filtration rate in normal weight subjects.
26148225 I148M variant in PNPLA3 reduces central adiposity and metabolic disease risks while increasing Nonalcoholic fatty liver disease.
26139292 PNPLA3 genetic variants and BMI played important roles in hepatic steatosis among Asian chronic hepatitis C patients.
26136587 This study showed that carriers of the PNPLA3 148M allele with either fatty liver plus obesity or obesity alone have lower fasting circulating retinol concentrations.
25986529 PNPLA3 genetic polymorphism is associated with liver steatosis and chronic hepatitis B.
25964223 PNPLA3 genetic polymorphism (rs738409 C>G) is associated with increased risk for the entire spectrum of alcoholic liver disease. [Review and Meta-Analysis]
25939720 The PNPLA3 rs738409 polymorphism is associated already in youths with increased alanine transaminase, and is more frequent in obese with metabolic syndrome of all ages
25801076 In patients with genotype 1 hepatitis C, the PNPLA3 G variant is associated with a higher risk of steatosis severity and steatohepatitis, particularly among non-obese subjects
25791171 findings suggest that the rs738409 polymorphism in PNPLA3 gene confers high cross-ethnicity risk for NAFLD and NASH development
25776890 PNPLA3 mRNA levels in the liver of the same section of a biopsy specimen used for genomic DNA preparation were lower in patients with advanced NAFLD compared with those with mild NAFLD and correlated inversely with CpG99 methylation in liver DNA.
25678388 The role of hepatic copper concentration and ATP7B mutations in steatosis development deserve further investigations.
25676803 PNPLA3 148M allele carriers had higher plasma levels of irisin.
25655569 These results demonstrate that SREBP-1c is a direct activator of the human PNPLA3 gene and insulin transactivates the PNPLA3 gene via the PI3K-SREBP-1c/NFY pathway in HepG2 cells
25646328 PNPLA3 single nucleotide polymorphism rs738409 was associated during the course of pregnancies complicated by gestational diabetes with liver enzyme elevation and reduced insulin resistance and prevalence of large for gestational age newborns.
25624712 Review: PNPLA3 I148M variant is associated with nonalcoholic fatty liver disease in women and association varies among different ethnic populations.
25581573 PNPLA3 polymorphism is a predictive factor in the development of liver steatosis in patients with chronic hepatitis C.
25543233 The PNPLA3 rs738409 variant influences histological liver damage in Japanese patients with chronic hepatitis C. The G allele homozygotes are at higher risk for hepatic steatosis, severe necroinflammation, and advanced fibrosis.
25536644 PNPLA3 variant distribution did not differ among hepatitis B and C coinfected patients with or without hepatocellular carcinoma.
25522307 In the present study, we found that the G-allele of PNPLA3 rs738409 was associated not only with NAFLD but also with moderate-to-severe steatosis in Chinese children.
25457210 The PNPLA3 genetic polymorphism at rs738409 was verified in 1077 biopsy-proven chronic hepatitis C patients. Other clinical variables, including diabetes status, were analysed for factors associated with bridging fibrosis.
25378656 rs738409 (I148M) variant of the PNPLA3 gene and cirrhosis
25297933 PNPLA3 p.148Met allele was underrepresented in the ICP cohort .. we conclude that the PNPLA3 allele p.148Met might confer protection against cholestatic pruritus, possibly due to increased LPA-acyltransferase activity
25290313 Our data suggest the PNPLA3 I148M polymorphism influences susceptibility to NAFLD in the Han and Uygur of Northwestern China.
25284145 PNPLA3 was associated with the presence and severity of hepatic steatosis and steatohepatitis, iron deposition and lobular inflammation in chronic hepatitis B.
25273282 Cox multivariate analysis identified the PNPLA3 I148M genotype as an independent predictor actuarial survival free of liver transplantation
25250621 Stratifying patients with the GPR120 270H variant based on PNPLA3 polymorphism, we demonstrated a significant interaction effect on alanine transaminase levels suggesting a driving effect of PNPLA3 148M allele on liver injury in children with obesity...
25240529 The PNPLA3 rs738409 GG genotype increases susceptibility of NASH in severely obese Asians with NAFLD and correlates to histologic severity of NAFLD.
25171251 Data indicate an interaction between homozygosity for the patatin-like phospholipase domain-containing 3 protein (PNPLA3) I148M variant and age at infection in determining fibrosis progression in CHC patients.
25069572 The PNPLA3 rs738409 polymorphism is common and may confer a significant risk of nonalcoholic fatty liver disease and advanced liver fibrosis in the Korean population.
25060292 The rs738409 variant of PNPLA3 is clearly associated with alcoholic liver cirrhosis.
25040896 PNPLA3 rs738409 GG genotype confers a higher risk of NAFLD, these patients are more sensitive to the beneficial effects of lifestyle modification.
24972532 PNPLA3 (I148M) was associated with a strong increase (1.75-fold) in liver TAGs, but with no change in other lipid fractions.
24947803 A significant association observed for PNAPLA3 rs738409 polymorphism with susceptibility to non-alcoholic fatty liver disease.
24947770 There is a lower prevalence of metabolic syndrome3 and reduced cardiovascular risk in non-alcoholic fatty liver disease patients with PNPLA3MM genotype.
24927606 PNPLA3 allele-G modulated the development of steatosis in hepatitis C, particularly in patients with HCV-1 and IL28B-CT/TT genotype.
24917523 Neither ablation nor overexpression of wild-type PNPLA3 affects liver fat content in mice, whereas hepatic overexpression of the human 148M transgene causes steatosis.
24916969 PNPLA3 148M allele carriers had higher plasma ALT levels and larger increase in ALT levels during follow-up than non-carriers only among overweight children.
24905495 PNPLA3 G/G genotype was associated with high liver fibrosis progression rate in HIV/HCV-coinfected patients
24831885 three variants in PNPLA3 gene may be a genetic risk factor for NASH
24828988 Results show liver fat accumulation and the I148M variant of PNPLA3 are associated with serum Fetuin-A levels independently of insulin resistance
24785259 genetic association studies in population in Japan: Data suggest that SNPs in PNPLA3 (rs738409), GCKR (glucokinase regulatory protein, rs780094), and TRIB1 (tribbles pseudokinase 1, rs2954021) are associated with nonalcoholic fatty liver disease.
24763554 Results suggest a critical role of PNPLA3 in the modulation of liver metabolism beyond its classical participation in triacylglycerol remodeling.
24689094 Healthy PNPLA3 risk allele carriers present with unexpected body fat composition.
24680680 Human adiponutrin is present in plasma as disulfide bond-dependent multimers.
24670599 PNPLA3 is a lipase responsible for retinyl-palmitate hydrolysis in hepatic stellate cells in humans.
24621583 Our results suggested that variations, including insertion/deletions, in PARVB, as well as those in PNPLA3, are important in the progression of NAFLD.
24607626 Carriage of the PNPLA3 rs738409 C >G polymorphism is not only associated with greater risk of progressive steatohepatitis and fibrosis but also of hepatocellular carcinoma.
24607626 Amongst patients with Non-Alcoholic Fatty Liver Disease (NAFLD), PNPLA3 rs738409 (I148M) variant homozygote carriage gives a 5-fold increased risk of developing hepatocellular carcinoma, independent of the presence of cirrhosis.
24553484 SNP genotype of PNPLA3 and LDL receptor did not have a significant impact on therapeutic outcomes
24511104 A novel function of PNPLA3 in fatty acid-selective triacylglycerol (TAG) remodeling, resulting in increased TAG saturation.
24477042 enetic association studies in Han Chinese population in Taiwan: Data suggest that an SNP in PNPLA3 (rs738409) is associated with increased susceptibility/risk of nonalcoholic fatty liver disease in the population of obese children studied.
24461483 We show results that suggest a possible role of PNPLA3 polymorphism as a risk factor for carotid atherosclerosis in chronic hepatitis C.
24417250 The G allele in PNPLA3 rs738409 increases the risk of non-alcoholic fatty liver disease independent of dietary pattern and metabolic factors; this variant has a greater impact on hepatic steatosis in subjects without metabolic syndrome.
24369119 Our data show that PNPLA3 has a predominant lipase activity and I148M mutation results in a loss of function.
24349054 Data found no association between PNPLA3 rs738409 genotype and fatty change of the liver or hepatic cirrhosis was found in Japanese patients infected with HCV.
24269995 In North African subjects, results show the PNPLA3 I148M variant apparently stimulates liver cancer development without interfering on the HCV clearance process.
24222941 Review: PNPLA3 is a novel key player in liver disease progression.
24222094 Review: report association between PNPLA3 genetic variation and non-alcoholic fatty liver disease.
24155878 PNPLA3 148M is over-represented in alcoholic liver disease or nonalcoholic fatty liver disease hepatocellular carcinoma patients.
24152445 Carriers of both PNPLA3 and SREBP1c risk genotypes displayed significantly (p = 0.005) higher median liver stiffness.
24123231 Donor PNPLA3 rs738409 genotype affects fibrosis progression in liver transplantation for hepatitis C.
24102786 Age at onset of at-risk alcohol consumption and PNPLA3 I148M genetic variant are independently associated with alcoholic cirrhosis incidence.
24069270 PNPLA3 GG genotype is associated with higher severity of carotid atherosclerosis in younger patients with NAFLD. Mechanisms underlying this association, and its clinical relevance need further investigations.
24009255 'PNPLA3 fatty liver disease' is associated with a relative deficiency of triacylglycerols, supporting the idea that the I148M variant impedes intrahepatocellular lipolysis rather than stimulates triacylglycerol synthesis.
24005099 This is related to lipid metabolism and its polymorphism may possibly be related to hepatic aberrations. Risk factors of polymorphism of this gene has been reported in relation to alcoholic liever disease and other hepatic dysfunctions. [Review]
23913731 PNPLA3 genotype significantly influences liver enzymes (and liver fat) independent of other factors; PNPLA3 genotype is not associated with adipocyte size in nonalcoholic fatty liver disease
23872669 Liver transplant recipients who carry rs738409-G in PNPLA3 are at increased risk for hepatic triglyceride accumulation, independent of the graft PNPLA3 genotype.
23859071 recipient PNPLA-3 G allele (non-CC genotype) is independently associated with increased risk of obesity after liver transplantation.
23808989 PNPLA3 polymorphism influenced the development of liver steatosis, but not fibrosis progression.
23804528 We have shown that variants of PNPLA3 and APOC3 independently and in an additive manner contribute to elevated hepatic triglyceride content in Hispanic children.
23800943 GCKR and PNPLA3 genes interact to result in increased susceptibility to NAFLD.
23776098 Polymorphism in PNPLA3 gene is associated with hepatocellular carcinoma.
23734760 Asian Indians in north India carrying the allele rs738490 of PNPLA3 is predispose to develop nonalcoholic fatty liver disease
23564580 In chronic hepatitis B patients, the PNPLA3 I148M polymorphism influences susceptibility to steatosis and, in particular, when associated with severe overweight and alcohol intake, severe steatosis.
23535911 Polymorphisms in the SAMM50 and PARVB genes in addition to those in the PNPLA3 gene were observed to be associated with the development and progression of NAFLD.
23512881 PNPLA3 polymorphism rs738409 was associated with non-alcoholic steatohepatitis and the severity of necroinflammatory changes independently of metabolic factors.
23510779 The I148M PNPLA3 variant is strongly associated with elevated alanine transaminase levels in normal weight and overweight/obese Mexican children.
23505555 In male PSC patients with severe disease with bile duct stenosis requiring intervention, the common I148M variant of the PNPLA3 gene is a risk factor for reduced survival.
23418085 In this cohort of patients with medically complicated obesity, PNPLA3 rs738409 G allelic expression is associated with hepatic (NASH) and nonhepatic complications of obesity, such as insulin resistance.
23416328 Some, but not all, associations between variants in NCAN, lysophospholipase-like 1, GCKR, and PPP1R3B with hepatic steatosis (with and without increased ALT level) were significant within subpopulations.
23398201 PNPLA3 exhibits a dual function in lipid droplet metabolism, and participates in the restoration of lipid homeostasis upon aberrant intracellular lipid accumulation.
23334462 genetic variation in PNPLA3 has a role in non-alcoholic fatty liver disease, but not in inflammation (which is due to obesity in NAFLD).
23333103 The rs738409 genetic variant in the patatin-like phospholipase domain-containing 3 (PNPLA3, adiponutrin) gene in hepatocellular carcinoma (Review)
23278404 Interaction between LEPR and PNPLA3 genes showed increased risk of NAFLD compared to either gene alone.
23226254 PNPLA3 genetic polymorphisms might influence the susceptibility to non-alcoholic fatty liver disease development independently or jointly in Han Chinese.
23176674 The PNPLA3 I148M variant is associated with the ultrasonography-determined steatosis degree in Chinese population.
23155331 Review: role of PNPLA3 genotype in predisposition to nonalcoholic fatty liver disease.
23069476 PNPLA3 rs738409 polymorphism genotype influences hepatocellular carcinoma occurrence and risk in patients with alcoholic cirrhosis.
23042597 PNPLA3 polymorphism reduces the binding affinity for palmitic acid.
23032985 Study assessed prevalence of fatty liver histology in general population from an autopsy study. The finding of an additive interaction among rs738409, obesity, and alcohol towards NAS may be useful in preventative care to those at highest risk for ALD.
22978414 In HCV genotype 2 infected patients carrying the PNPLA3 148M allele, there was significantly increased insulin resistance (P = 0.023) and lower viral load (P = 0.005) at baseline as well as the first seven days of antiviral treatment.
22898488 Modulation of serum adiponectin might be involved in mediating the susceptibility to steatosis, steatohepatitis, and hepatocellular carcinoma in carriers of the 148 M PNPLA3 variant without chronic hepatitis C.
22884299 In this mini-review, we summarize the current knowledge on (i) PNPLA3 variant(s) in the pathogenesis of liver diseases, and (ii) PNPLA3 gene regulation and potential function in liver
22878467 PNPLA3 148M promotes intracellular lipid accumulation in the liver by reducing the lipidation of VLDL.
22869157 The G/G genotype of PNPLA3 rs738409 SNP might affect hepatocellular carcinoma prognosis in alcoholic liver disease patients.
22863562 This population study highlights a sex-specific association of PNPLA3 polymorphisms and elevated liver enzymes in a population-based study, independent of common pathological factors of the metabolic syndrome.
22841784 confirmed the role of the PNPLA3 nonsynonymous I148M variant in progression of liver fibrosis.
22792295 The G-allele of PNPLA3 rs738409 associates with reduced fasting levels of cholesterol and triglyceride in individuals with impaired glucose regulation.
22724004 Severely obese individuals carrying the PNPLA3 148M allele have lower serum triglyceride levels, are more insulin resistant and more susceptible to T2D.
22719876 demonstrated that Matteoni type4 NAFLD is both a genetically and clinically different subset from the other spectrums of the disease and that the PNPLA3 gene is strongly associated with the progression of NASH in Japanese population
22719190 The PNPLA3 I148M polymorphism may represent a permissive factor for fibrosis progression in patients with C282Y+/+ hereditary hemochromatosis.
22704398 A significantly higher incidence of hepatocellular carcinoma in PNPLA3 148M allele carriers was found during follow-up in obese individuals in the control group (conventional obesity treatment), but not in the bariatric surgery group.
22629460 the association of a high dietary polyunsaturated fatty acid intake with fatty liver and liver damage in obese youths may be driven by a predisposing PNPLA3 genotype.
22546774 The presence of the PNPLA3 variant genotype, particularly in the context of high VAT content may have an important role in FLD.
22543885 associated with hepatic steatosis prevalence and severity in Caucasians with genotype 1 chronic hepatitis C infection
22530607 PNPLA3 p.148M/M genotype was negatively associated with sustained virological response and an association between IL28B CC genotype and more severe liver fibrosis.
22338072 PNPLA3 in human hepatocytes is induced by glucose via a mechanism involving ChREBP. The I148M mutant inhibits breakdown of hepatocellular triglycerides. Free fatty acids potentiate the effect of PNPLA3 I148M on triglcyeride accumulation.
22314430 In non-alcoholic fatty liver disease patients, IL28B rs12979860 CC genotype, together with PNPLA3 rs738409 GG, is associated with the severity of liver damage.
22276112 The absence of an association of PNPLA3 p.I148M with alcoholic CP seems not to point to a common pathway in the development of alcoholic CP and alcoholic liver cirrhosis.
22258181 findings showed an association between rs738409 of the PNPLA3 gene and the risk of non-alcoholic fatty liver disease in the pooled subjects and after stratification into the three ethnic subgroups; rs738409 G allele was significantly associated with progression to non-alcoholic steatohepatitis and fibrosis
22189977 PNPLA3 polymorphisms were initially described as predictors of nonalcoholic fatty liver disease, but have recently been associated with disease progression in HCV [review]
22162034 PNPLA3 (rs738409 C>G) is a common risk variant associated with hepatocellular carcinoma in alcoholic cirrhosis.
22141340 Genetic variants in PNPLA3 but not APOC3 contribute to the variance in liver fat content due to non-alcoholic fatty liver disease.
22140488 The magnitude of the association of PNPLA3 with liver enzymes is driven by the size of abdominal fat.
22105854 The rs1260326 in GCKR is associated with hepatic fat accumulation along with large VLDL and triglyceride levels. GCKR and PNPLA3 act together to convey susceptibility to fatty liver in obese youths.
22087248 PNPLA3 148M variant is a prominent risk factor for hepatitis C cirrhosis in patients with alcoholic cirrhosis, while its effects are negligible in patients with cirrhosis due to hepatitis C virus.
21898508 We document an association between PNPLA3-I148M and hepatic steatosis in a population from mainland China.
21893698 homozygous carriers of the PNPLA3 variant p.I148M display higher fasting glucose; although this adiponutrin variant may affect triglyceride homeostasis, it does not increase the risk of cholelithiasis
21878620 PNPLA3 plays a role in the hydrolysis of glycerolipids and that the I148M substitution causes a loss of function, although we cannot exclude the possibility that the enzyme has additional substrates or activities
21777557 The APOC3 T-455C and C-482T promoter region polymorphisms are not associated with the severity of liver damage independently of PNPLA3 I148M genotype in patients with nonalcoholic fatty liver.
21745307 In patients with type 2 diabetes who were not selected for liver abnormalities, liver fibrosis was related to the rs738409 polymorphism independent of body mass index or liver fat content.
21745286 The PNPLA3 rs738409 C>G polymorphism is associated with cirrhosis. In synergy with gender, this polymorphism is a strong predictor of hepatocellular carcinoma occurrence among patients with cirrhosis.
21745282 Report an association between the PNPLA3-I148M polymorphism and insulin resistance and nonalcoholic fatty liver disease in a normoglycaemic population.
21665509 These findings provide evidence that the PNPLA3 SNP rs738409 contributes to risk for increased liver fat content in African Americans with type 2 diabetes.
21525193 Weight loss is effective in decreasing liver fat in subjects who are homozygous for the rs738409 PNPLA3 G or C allele
21488075 The PNPLA3 (rs738409 C>G) polymorphism favors steatosis and fibrosis progression in chronic hepatitis C.
21381068 The single nucleotide polymorphism of PNPLA3 does affect the genetic susceptibility of nonalcoholic fatty liver in different populations around the world.
21334404 In European Caucasians, the rs738409 variant is associated with increased risk of alcoholic liver disease, liver damage, and cirrhosis.
21319195 rs738409 PNPLA3 genotype influences steatosis development in chronic hepatitis C and is independently associated with cirrhosis and other steatosis-related clinical outcomes, lack of response to antiviral treatment and possibly hepatocellular carcinoma.
21281435 We confirmed the association of a PNPLA3 variant with non-alcoholic fatty liver disease in Hispanic Americans and African Americans.
21254164 Genotype PNPLA3 rs738409(GG) is associated with alcoholic liver cirrhosis and elevated aminotransferase levels in alcoholic Caucasians.
21236304 The rs738409 single nucleotide polymorphism in PNPLA3 is associated with an increased risk of steatosis in patients infected with Hepatitis C Virus genotypes non-3.
21176169 The G-allele of rs738409 polymorphism in PNPLA3 is associated with plasma ALT, AST, and triglycerides levels, and the fibrosis stage.
21168459 Carriers of distinct p.I148M adiponutrin genotypes display significant (p=0.017) differences in liver stiffness determined by elastography. In particular, individuals carrying the allele [G] are at higher risk of developing liver cirrhosis.
21168155 The variant PNPLA3 rs738409 genotypes increased the risk of NAFLD in our population of obese Taiwanese children. The effect of the G allele on pediatric NAFLD followed a dominant genetic model.
21145868 adiponutrin/PNPLA3 is regulated by two key factors of the glycolytic and lipogenic pathways, raising the question of its implication in the metabolism of carbohydrates and lipids
21036152 The aim of this study was to determine whether glucose and insulin increase adiponutrin mRNA transcription by directly regulating the promoter region of the human adiponutrin/PNPLA3 gene.
20962157 findings suggest that Hispanic children carrying the GG genotype are susceptible to increased hepatic fat when dietary carbohydrate intake is high
20962157 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20852027 Effect of the PNPLA3 variant is apparent in Hispanic children and adolescents, is unique to fat deposition in liver as compared with other ectopic depots examined, and is associated with lower HDL cholesterol.
20852027 Observational study of gene-disease association. (HuGE Navigator)
20826584 Lack of relationship with visceral obesity andinverse correlation with crotid intima media thicknes suggests fatty liver association with the minor G allele of PNPLA3.
20826584 Observational study of gene-disease association. (HuGE Navigator)
20803499 A common variant of the PNPLA3 gene confers susceptibility to hepatic steatosis in obese youths without increasing the level of hepatic and peripheral insulin resistance
20803499 Observational study of gene-disease association. (HuGE Navigator)
20684021 There ias an association of genetic variability in patatin-like phospholipase domain-containing protein 3 (PNPLA3) with histological severity of nonalcoholic fatty liver disease.
20684021 Observational study of gene-disease association. (HuGE Navigator)
20648474 The PNPLA3 rs738409 polymorphism is associated with steatosis severity, hepatocellular ballooning, lobular inflammation, and perivenular fibrosis in pediatric nonalcoholic fatty liver disease.
20648474 Observational study of gene-disease association. (HuGE Navigator)
20648472 Genetic variation at PNPLA3 confers a markedly increased risk of increasingly severe histological features of nonalcoholic fatty liver disease, without a strong effect on metabolic syndrome component traits.
20648472 Observational study of gene-disease association. (HuGE Navigator)
20585554 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20546964 PNPLA3 gene I148M variant is associated with increased levels of ALT/AST in obese children and adolescents, suggesting that it confers genetic susceptibility to liver damage from a young age.
20546964 Observational study of gene-disease association. (HuGE Navigator)
20373368 Homozygosity for the patatin-like phospholipase-3/adiponutrin I148M polymorphism influences liver fibrosis in patients with nonalcoholic fatty liver disease.
20373368 Observational study of gene-disease association. (HuGE Navigator)
20034933 PNPLA3-I148M promotes triglyceride accumulation by limiting triglyceride hydrolysis
19946271 Data show that that rs738409 in PNPLA3 is strongly associated with alcoholic liver disease and clinically evident alcoholic cirrhosis.
19946271 Observational study of gene-disease association. (HuGE Navigator)
19844213 Obese Southern Europeans carrying the 148M allele have increased indices of liver damage uncoupled from proxy measures of insulin resistance.
19844213 Observational study of gene-disease association. (HuGE Navigator)
19738004 Data suggest that the adiponutrin rs738409 G allele is associated not only with fat accumulation in the liver but also with liver injury, possibly triggered by lipotoxicity.
19738004 Observational study of gene-disease association. (HuGE Navigator)
19729411 Adiponutrin is involved in the metabolism of apoB-containing lipoproteins.
19729411 Observational study of gene-disease association. (HuGE Navigator)
19651814 PNPLA3 may be an important key to understand the mechanisms discriminating fatty liver with and without metabolic consequences.
19651814 Observational study of gene-disease association. (HuGE Navigator)
19619606 PNPLA3 mRNA expression is upregulated by tri-iodothyronine in adipocytes in vitro, in humans and rats, and in vivo in rat white adipose tissue.
19596471 No association of a single nucleotide polymorphism in the adiponutrin gene and type 2 diabetes in a Chinese population.
19596471 Observational study of gene-disease association. (HuGE Navigator)
19542081 A strong recessive association of the adiponutrin polymorphism was found with age and gender adjusted ALT and AST concentrations: being homozygous for the minor allele resulted in a highly significant increase of ALT concentration.
19542081 Observational study of gene-disease association. (HuGE Navigator)
19524579 test whether knowledge of the recently discovered genetic variant in the PNPLA3 gene (rs738409) increases accuracy of the prediction of non-alcoholic fatty liver
19524579 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19390624 PNPLA3 effect on insulin sensitivity
19390624 Observational study of gene-disease association. (HuGE Navigator)
19239840 Polymorphic variations affect liver triglycerides and are associated with fatty liver.
19224197 A common variant in PNPLA3 increases the risk of hepatic steatosis in humans.
19224197 Observational study of gene-disease association. (HuGE Navigator)
18940312 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18820647 Variation in PNPLA3 contributes to ancestry-related and inter-individual differences in hepatic fat content and susceptibility to nonalcoholic fatty liver disease.
18820647 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18728122 association between PNPLA3 and obesity; the rs738409 variant was associated with insulin secretion
18728122 Observational study of gene-disease association. (HuGE Navigator)
16505250 Observational study of gene-disease association. (HuGE Navigator)
16150821 Adiponutrin and Desnutrin/ATGL have distinct functions and GS2 may contribute significantly to lipolysis in adipose tissue
15364929 iPLA2epsilon (adiponutrin), iPLA2zeta (TTS-2.2), and iPLA2eta (GS2) are three novel TAG lipases/acylglycerol transacylases that likely participate in TAG hydrolysis and the acyl-CoA independent transacylation of acylglycerols

AA Sequence

MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLS      1 - 70
DLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVD     71 - 140
ALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKL    141 - 210
SLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWAN    211 - 280
MSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRI    281 - 350
MSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT    351 - 420
PEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL             421 - 481
//

Text Mined References (200)

PMID Year Title
27015186 2016 Interactions of a PPARGC1A Variant and a PNPLA3 Variant Affect Nonalcoholic Steatohepatitis in Severely Obese Taiwanese Patients.
26847197 2016 Association of PNPLA3 rs738409 and TM6SF2 rs58542926 with health services utilization in a population-based study.
26760234 2016 Impact of patatin-like phospholipase domain-containing 3 gene polymorphism (rs738409) on severity of liver disease in HIV/hepatitis C virus-coinfected patients.
26745555 2016 Reduction of Caloric Intake Might Override the Prosteatotic Effects of the PNPLA3 p.I148M and TM6SF2 p.E167K Variants in Patients with Fatty Liver: Ultrasound-Based Prospective Study.
26745088 2015 Association of PNPLA3 Polymorphism with Hepatocellular Carcinoma Development and Prognosis in Viral and Non-Viral Chronic Liver Diseases.
26707313 2015 Impact of Donor and Recipient Single Nucleotide Polymorphisms in Living Liver Donor Transplantation for Hepatitis C.
26632699 2015 Significant Association Between Adiponutrin and Hepatocellular Carcinoma Risk.
26605757 2016 The rs2294918 E434K variant modulates patatin-like phospholipase domain-containing 3 expression and liver damage.
26599080 2015 The Impact of PNPLA3 rs738409 SNP on Liver Fibrosis Progression, Portal Hypertension and Hepatic Steatosis in HIV/HCV Coinfection.
26519102 2015 Adiponutrin (PNPLA3) in liver fibrogenesis: Is unaltered HepG2 cell line a better model system compared to murine models?
26493626 2016 PNPLA3 rs738409 and TM6SF2 rs58542926 variants increase the risk of hepatocellular carcinoma in alcoholic cirrhosis.
26485523 2015 The Impact of PNPLA3 rs738409 Genetic Polymorphism and Weight Gain ?10 kg after Age 20 on Non-Alcoholic Fatty Liver Disease in Non-Obese Japanese Individuals.
26482880 2015 A genome-wide association study confirms PNPLA3 and identifies TM6SF2 and MBOAT7 as risk loci for alcohol-related cirrhosis.
26439088 2015 The Genetic Variant I148M in PNPLA3 Is Associated With Increased Hepatic Retinyl-Palmitate Storage in Humans.
26379412 2015 PNPLA3 I148M variant affects non-alcoholic fatty liver disease in liver transplant recipients.
26355465 2016 PNPLA3 148M Carriers with Inflammatory Bowel Diseases Have Higher Susceptibility to Hepatic Steatosis and Higher Liver Enzymes.
26352693 2015 Genetic Polymorphisms of IL28B and PNPLA3 Are Predictive for HCV Related Rapid Fibrosis Progression and Identify Patients Who Require Urgent Antiviral Treatment with New Regimens.
26305067 2016 A Variant in PNPLA3 Associated With Fibrosis Progression but not Hepatocellular Carcinoma in Patients With Hepatitis C Virus Infection.
26272871 2015 Treating liver fat and serum triglyceride levels in NAFLD, effects of PNPLA3 and TM6SF2 genotypes: Results from the WELCOME trial.
26259026 2016 TM6SF2 rs58542926 is not associated with steatosis and fibrosis in large cohort of patients with genotype 1 chronic hepatitis C.
26229402 2015 Linked PNPLA3 polymorphisms confer susceptibility to nonalcoholic steatohepatitis and decreased viral load in chronic hepatitis B.
26200108 2015 Influence of the PNPLA3 rs738409 Polymorphism on Non-Alcoholic Fatty Liver Disease and Renal Function among Normal Weight Subjects.
26148225 2015 I148M variant in PNPLA3 reduces central adiposity and metabolic disease risks while increasing nonalcoholic fatty liver disease.
26139292 2015 PNPLA3 genetic variants determine hepatic steatosis in non-obese chronic hepatitis C patients.
26136587 2015 PNPLA3 I148M Variant Influences Circulating Retinol in Adults with Nonalcoholic Fatty Liver Disease or Obesity.
25986529 2015 Patatin-Like Phospholipase Domain-Containing 3 I148M Variant Is Associated with Liver Steatosis and Fat Distribution in Chronic Hepatitis B.
25964223 2015 PNPLA3 Gene Polymorphism Is Associated With Predisposition to and Severity of Alcoholic Liver Disease.
25939720 2015 Patatin-like phospholipase 3 (rs738409) gene polymorphism is associated with increased liver enzymes in obese adolescents and metabolic syndrome in all ages.
25801076 2015 PNPLA3 rs738409 I748M is associated with steatohepatitis in 434 non-obese subjects with hepatitis C.
25791171 2015 Association between patatin-like phospholipase domain containing 3 gene (PNPLA3) polymorphisms and nonalcoholic fatty liver disease: a HuGE review and meta-analysis.
25776890 2015 Targeted-bisulfite sequence analysis of the methylation of CpG islands in genes encoding PNPLA3, SAMM50, and PARVB of patients with non-alcoholic fatty liver disease.
25678388 2015 Hepatic steatosis in Wilson disease--Role of copper and PNPLA3 mutations.
25676803 2015 The 148 M allele of the PNPLA3 is associated with plasma irisin levels in a population sample of Caucasian children: The PANIC Study.
25655569 2015 The SRE Motif in the Human PNPLA3 Promoter (-97 to -88?bp) Mediates Transactivational Effects of SREBP-1c.
25646328 2015 Isoleucine-to-methionine substitution at residue 148 variant of PNPLA3 gene and metabolic outcomes in gestational diabetes.
25624712 2015 PNPLA3 I148M variant in nonalcoholic fatty liver disease: demographic and ethnic characteristics and the role of the variant in nonalcoholic fatty liver fibrosis.
25581573 2015 TM6SF2 E167K variant is associated with severe steatosis in chronic hepatitis C, regardless of PNPLA3 polymorphism.
25543233 2015 Effect of PNPLA3 rs738409 variant (I148 M) on hepatic steatosis, necroinflammation, and fibrosis in Japanese patients with chronic hepatitis C.
25536644 Hepatocellular carcinoma in chronic HBV-HCV co-infection is correlated to fibrosis and disease duration.
25522307 2015 GWAS-Identified Common Variants With Nonalcoholic Fatty Liver Disease in Chinese Children.
25457210 2015 Association of diabetes and PNPLA3 genetic variants with disease severity of patients with chronic hepatitis C virus infection.
25378656 2015 The rs738409 (I148M) variant of the PNPLA3 gene and cirrhosis: a meta-analysis.
25297933 2014 Variant adiponutrin confers genetic protection against cholestatic itch.
25290313 2014 Association between the PNPLA3 I148M polymorphism and non-alcoholic fatty liver disease in the Uygur and Han ethnic groups of northwestern China.
25284145 2015 The impact of PNPLA3 (rs738409 C>G) polymorphisms on liver histology and long-term clinical outcome in chronic hepatitis B patients.
25273282 2014 PNPLA3 in end-stage liver disease: alcohol consumption, hepatocellular carcinoma development, and transplantation-free survival.
25250621 2014 Novel association between a nonsynonymous variant (R270H) of the G-protein-coupled receptor 120 and liver injury in children and adolescents with obesity.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
25240529 PNPLA3 genotype increases susceptibility of nonalcoholic steatohepatitis among obese patients with nonalcoholic fatty liver disease.
25171251 2014 Interaction between PNPLA3 I148M variant and age at infection in determining fibrosis progression in chronic hepatitis C.
25069572 2014 Role of the PNPLA3 I148M polymorphism in nonalcoholic fatty liver disease and fibrosis in Korea.
25060292 2014 Systematic review with meta-analysis: the I148M variant of patatin-like phospholipase domain-containing 3 gene (PNPLA3) is significantly associated with alcoholic liver cirrhosis.
25040896 2015 PNPLA3 gene polymorphism and response to lifestyle modification in patients with nonalcoholic fatty liver disease.
24972532 2014 PNPLA3 variant I148M is associated with altered hepatic lipid composition in humans.
24947803 2015 Association of genetic variants with non-alcoholic fatty liver disease in an urban Sri Lankan community.
24947770 2014 Non-alcoholic fatty liver disease, metabolic syndrome and patatin-like phospholipase domain-containing protein3 gene variants.
24927606 PNPLA3 rs738409 causes steatosis according to viral & IL28B genotypes in hepatitis C.
24917523 2015 Pnpla3I148M knockin mice accumulate PNPLA3 on lipid droplets and develop hepatic steatosis.
24916969 2015 Associations of I148M variant in PNPLA3 gene with plasma ALT levels during 2-year follow-up in normal weight and overweight children: the PANIC Study.
24905495 2015 Revisiting liver disease progression in HIV/HCV-coinfected patients: the influence of vitamin D, insulin resistance, immune status, IL28B and PNPLA3.
24831885 2014 Genetic variants in the PNPLA3 gene are associated with nonalcoholic steatohepatitis.
24828988 2014 Hepatic steatosis and PNPLA3 I148M variant are associated with serum Fetuin-A independently of insulin resistance.
24785259 2014 Association of polymorphisms in GCKR and TRIB1 with nonalcoholic fatty liver disease and metabolic syndrome traits.
24763554 2014 Metabolic profiling reveals that PNPLA3 induces widespread effects on metabolism beyond triacylglycerol remodeling in Huh-7 hepatoma cells.
24689094 2014 Healthy PNPLA3 risk allele carriers present with unexpected body fat composition. A study of one thousand subjects.
24680680 2014 Adiponutrin: a multimeric plasma protein.
24670599 2014 PNPLA3 has retinyl-palmitate lipase activity in human hepatic stellate cells.
24621583 2014 Targeted next-generation sequencing and fine linkage disequilibrium mapping reveals association of PNPLA3 and PARVB with the severity of nonalcoholic fatty liver disease.
24607626 2014 Carriage of the PNPLA3 rs738409 C >G polymorphism confers an increased risk of non-alcoholic fatty liver disease associated hepatocellular carcinoma.
24553484 2014 Impact of comorbid hepatic steatosis on treatment of chronic hepatitis C in Japanese patients and the relationship with genetic polymorphism of IL28B, PNPLA3 and LDL receptor.
24511104 2014 PNPLA3 mediates hepatocyte triacylglycerol remodeling.
24477042 2014 Genetic variants in GCKR and PNPLA3 confer susceptibility to nonalcoholic fatty liver disease in obese individuals.
24461483 2014 PNPLA3 I148M variant as a risk factor for carotid atherosclerosis in chronic hepatitis C.
24417250 2014 PNPLA3 gene polymorphism accounts for fatty liver in community subjects without metabolic syndrome.
24369119 2014 Recombinant PNPLA3 protein shows triglyceride hydrolase activity and its I148M mutation results in loss of function.
24349054 2013 No correlation between PNPLA3 rs738409 genotype and fatty liver and hepatic cirrhosis in Japanese patients with HCV.
24269995 2014 The adiponutrin I148M variant is a risk factor for HCV-associated liver cancer in North-African patients.
24222941 2013 PNPLA3 I148M polymorphism and progressive liver disease.
24222094 2013 PNPLA3-associated steatohepatitis: toward a gene-based classification of fatty liver disease.
24155878 2013 PNPLA3 I148M polymorphism, clinical presentation, and survival in patients with hepatocellular carcinoma.
24152445 2013 Identification of combined genetic determinants of liver stiffness within the SREBP1c-PNPLA3 pathway.
24123231 2014 Donor PNPLA3 rs738409 genotype affects fibrosis progression in liver transplantation for hepatitis C.
24102786 2014 PNPLA3 I148M (rs738409) genetic variant and age at onset of at-risk alcohol consumption are independent risk factors for alcoholic cirrhosis.
24069270 2013 PNPLA3 GG genotype and carotid atherosclerosis in patients with non-alcoholic fatty liver disease.
24009255 2014 Circulating triacylglycerol signatures in nonalcoholic fatty liver disease associated with the I148M variant in PNPLA3 and with obesity.
24005099 2013 [Genetic predisposition related to non-alcoholic fatty liver disease].
23913731 2013 Adipocyte size is associated with NAFLD independent of obesity, fat distribution, and PNPLA3 genotype.
23872669 2013 Patatin-like phospholipase domain-containing protein 3 rs738409-G in recipients of liver transplants is a risk factor for graft steatosis.
23859071 2013 Investigation of PNPLA3 and IL28B genotypes on diabetes and obesity after liver transplantation: insight into mechanisms of disease.
23808989 2013 Abdominal fat interacts with PNPLA3 I148M, but not with the APOC3 variant in the pathogenesis of liver steatosis in chronic hepatitis C.
23804528 2013 Genetic and clinical markers of elevated liver fat content in overweight and obese Hispanic children.
23800943 2014 Association of glucokinase regulatory gene polymorphisms with risk and severity of non-alcoholic fatty liver disease: an interaction study with adiponutrin gene.
23776098 2013 Genetic variation in the PNPLA3 gene and hepatocellular carcinoma in USA: risk and prognosis prediction.
23734760 2013 Genetic variation in the patatin-like phospholipase domain-containing protein-3 (PNPLA-3) gene in Asian Indians with nonalcoholic fatty liver disease.
23564580 2013 Patatin-like phospholipase domain-containing 3 I148M affects liver steatosis in patients with chronic hepatitis B.
23535911 2013 Genome-wide scan revealed that polymorphisms in the PNPLA3, SAMM50, and PARVB genes are associated with development and progression of nonalcoholic fatty liver disease in Japan.
23512881 2013 A gene variant of PNPLA3, but not of APOC3, is associated with histological parameters of NAFLD in an obese population.
23510779 2013 Association of the I148M/PNPLA3 variant with elevated alanine transaminase levels in normal-weight and overweight/obese Mexican children.
23505555 2013 A frequent PNPLA3 variant is a sex specific disease modifier in PSC patients with bile duct stenosis.
23418085 2013 Interactions of allelic variance of PNPLA3 with nongenetic factors in predicting nonalcoholic steatohepatitis and nonhepatic complications of severe obesity.
23416328 2013 Association between variants in or near PNPLA3, GCKR, and PPP1R3B with ultrasound-defined steatosis based on data from the third National Health and Nutrition Examination Survey.
23398201 2013 PNPLA3/adiponutrin functions in lipid droplet formation.
23334462 2013 Adipose tissue is inflamed in NAFLD due to obesity but not in NAFLD due to genetic variation in PNPLA3.
23333103 2013 PNPLA3 I148M variant and hepatocellular carcinoma: a common genetic variant for a rare disease.
23278404 2013 Impact of leptin receptor gene variants on risk of non-alcoholic fatty liver disease and its interaction with adiponutrin gene.
23226254 2012 Genetic variants in PNPLA3 and risk of non-alcoholic fatty liver disease in a Han Chinese population.
23176674 2012 Genetic variant I148M in PNPLA3 is associated with the ultrasonography-determined steatosis degree in a Chinese population.
23155331 2012 PNPLA3, the triacylglycerol synthesis/hydrolysis/storage dilemma, and nonalcoholic fatty liver disease.
23069476 2013 PNPLA3 rs738409, hepatocellular carcinoma occurrence and risk model prediction in patients with cirrhosis.
23042597 2013 Molecular dynamics simulation of PNPLA3 I148M polymorphism reveals reduced substrate access to the catalytic cavity.
23032985 2012 The interaction of rs738409, obesity, and alcohol: a population-based autopsy study.
22978414 2012 PNPLA 3 I148M genetic variant associates with insulin resistance and baseline viral load in HCV genotype 2 but not in genotype 3 infection.
22898488 2012 The I148M PNPLA3 polymorphism influences serum adiponectin in patients with fatty liver and healthy controls.
22884299 2013 PNPLA3, a genetic marker of progressive liver disease, still hiding its metabolic function?
22878467 2012 Patatin-like phospholipase domain-containing 3 (PNPLA3) I148M (rs738409) affects hepatic VLDL secretion in humans and in vitro.
22869157 2013 The impact of patatin-like phospholipase domain-containing protein 3 polymorphism on hepatocellular carcinoma prognosis.
22863562 2012 PNPLA3 polymorphisms and liver aminotransferase levels in a Mexican American population.
22841784 2012 Genome-wide association study identifies variants associated with progression of liver fibrosis from HCV infection.
22792295 2012 The PNPLA3 rs738409 G-allele associates with reduced fasting serum triglyceride and serum cholesterol in Danes with impaired glucose regulation.
22724004 2012 Paradoxical lower serum triglyceride levels and higher type 2 diabetes mellitus susceptibility in obese individuals with the PNPLA3 148M variant.
22719876 2012 Genetic polymorphisms of the human PNPLA3 gene are strongly associated with severity of non-alcoholic fatty liver disease in Japanese.
22719190 2012 Patatin-like phospholipase domain containing-3 gene I148M polymorphism, steatosis, and liver damage in hereditary hemochromatosis.
22704398 2012 PNPLA3 I148M (rs738409) genetic variant is associated with hepatocellular carcinoma in obese individuals.
22629460 2012 Hepatic fat accumulation is modulated by the interaction between the rs738409 variant in the PNPLA3 gene and the dietary omega6/omega3 PUFA intake.
22546774 2013 PNPLA3 gene-by-visceral adipose tissue volume interaction and the pathogenesis of fatty liver disease: the NHLBI family heart study.
22543885 2012 The association of genetic variants with hepatic steatosis in patients with genotype 1 chronic hepatitis C infection.
22530607 2012 Implications of PNPLA3 polymorphism in chronic hepatitis C patients receiving peginterferon plus ribavirin.
22338072 2012 PNPLA3 is regulated by glucose in human hepatocytes, and its I148M mutant slows down triglyceride hydrolysis.
22314430 2012 IL28B and PNPLA3 polymorphisms affect histological liver damage in patients with non-alcoholic fatty liver disease.
22276112 2012 A common variant of PNPLA3 (p.I148M) is not associated with alcoholic chronic pancreatitis.
22258181 2012 A multi-ethnic study of a PNPLA3 gene variant and its association with disease severity in non-alcoholic fatty liver disease.
22189977 2011 The impact of human gene polymorphisms on HCV infection and disease outcome.
22162034 2012 PNPLA3 (rs738409 C>G) is a common risk variant associated with hepatocellular carcinoma in alcoholic cirrhosis.
22141340 2012 Genetic variation in PNPLA3 but not APOC3 influences liver fat in non-alcoholic fatty liver disease.
22140488 2011 The association of PNPLA3 variants with liver enzymes in childhood obesity is driven by the interaction with abdominal fat.
22105854 2012 Variant in the glucokinase regulatory protein (GCKR) gene is associated with fatty liver in obese children and adolescents.
22087248 2011 The PNPLA3 rs738409 148M/M genotype is a risk factor for liver cancer in alcoholic cirrhosis but shows no or weak association in hepatitis C cirrhosis.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21898508 2012 Genetic variant in PNPLA3 is associated with nonalcoholic fatty liver disease in China.
21893698 2011 The common adiponutrin variant p.I148M does not confer gallstone risk but affects fasting glucose and triglyceride levels.
21878620 2011 Expression and characterization of a PNPLA3 protein isoform (I148M) associated with nonalcoholic fatty liver disease.
21777557 2011 The APOC3 T-455C and C-482T promoter region polymorphisms are not associated with the severity of liver damage independently of PNPLA3 I148M genotype in patients with nonalcoholic fatty liver.
21745307 2011 PNPLA3 polymorphism influences liver fibrosis in unselected patients with type 2 diabetes.
21745286 2011 PNPLA3 rs738409C/G polymorphism in cirrhosis: relationship with the aetiology of liver disease and hepatocellular carcinoma occurrence.
21745282 2011 The PNPLA3 I148M polymorphism is associated with insulin resistance and nonalcoholic fatty liver disease in a normoglycaemic population.
21665509 2011 Association of PNPLA3 SNP rs738409 with liver density in African Americans with type 2 diabetes mellitus.
21525193 2011 Genetic variation in PNPLA3 (adiponutrin) confers sensitivity to weight loss-induced decrease in liver fat in humans.
21488075 2011 Impact of patatin-like phospholipase-3 (rs738409 C>G) polymorphism on fibrosis progression and steatosis in chronic hepatitis C.
21423719 2011 Genome-wide association analysis identifies variants associated with nonalcoholic fatty liver disease that have distinct effects on metabolic traits.
21381068 2011 Meta-analysis of the influence of I148M variant of patatin-like phospholipase domain containing 3 gene (PNPLA3) on the susceptibility and histological severity of nonalcoholic fatty liver disease.
21334404 2011 Common polymorphism in the PNPLA3/adiponutrin gene confers higher risk of cirrhosis and liver damage in alcoholic liver disease.
21319195 2011 Patatin-like phospholipase domain-containing 3 I148M polymorphism, steatosis, and liver damage in chronic hepatitis C.
21281435 2011 Association of PNPLA3 with non-alcoholic fatty liver disease in a minority cohort: the Insulin Resistance Atherosclerosis Family Study.
21254164 2011 Genetic variation in the PNPLA3 gene is associated with alcoholic liver injury in caucasians.
21236304 2011 Viral genotype-specific role of PNPLA3, PPARG, MTTP, and IL28B in hepatitis C virus-associated steatosis.
21176169 2010 Association of the rs738409 polymorphism in PNPLA3 with liver damage and the development of nonalcoholic fatty liver disease.
21168459 2011 Variant adiponutrin (PNPLA3) represents a common fibrosis risk gene: non-invasive elastography-based study in chronic liver disease.
21168155 2011 A common variant in the PNPLA3 gene is a risk factor for non-alcoholic fatty liver disease in obese Taiwanese children.
21145868 2011 Distinct regulation of adiponutrin/PNPLA3 gene expression by the transcription factors ChREBP and SREBP1c in mouse and human hepatocytes.
21036152 2010 Regulation of the promoter region of the human adiponutrin/PNPLA3 gene by glucose and insulin.
20962157 2010 Increased hepatic fat in overweight Hispanic youth influenced by interaction between genetic variation in PNPLA3 and high dietary carbohydrate and sugar consumption.
20852027 2010 Effects of PNPLA3 on liver fat and metabolic profile in Hispanic children and adolescents.
20826584 2010 Specifically PNPLA3-mediated accumulation of liver fat in obese patients with type 2 diabetes.
20803499 2010 A common variant in the patatin-like phospholipase 3 gene (PNPLA3) is associated with fatty liver disease in obese children and adolescents.
20684021 2010 The association of genetic variability in patatin-like phospholipase domain-containing protein 3 (PNPLA3) with histological severity of nonalcoholic fatty liver disease.
20648474 2010 I148M patatin-like phospholipase domain-containing 3 gene variant and severity of pediatric nonalcoholic fatty liver disease.
20648472 2010 PNPLA3 variants specifically confer increased risk for histologic nonalcoholic fatty liver disease but not metabolic disease.
20585554 2010 On the use of variance per genotype as a tool to identify quantitative trait interaction effects: a report from the Women's Genome Health Study.
20546964 2010 The 148M allele of the PNPLA3 gene is associated with indices of liver damage early in life.
20373368 2010 Homozygosity for the patatin-like phospholipase-3/adiponutrin I148M polymorphism influences liver fibrosis in patients with nonalcoholic fatty liver disease.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20034933 2010 A sequence variation (I148M) in PNPLA3 associated with nonalcoholic fatty liver disease disrupts triglyceride hydrolysis.
19946271 2010 Variant in PNPLA3 is associated with alcoholic liver disease.
19844213 2010 Morbid obesity exposes the association between PNPLA3 I148M (rs738409) and indices of hepatic injury in individuals of European descent.
19738004 2009 A nonsynonymous gene variant in the adiponutrin gene is associated with nonalcoholic fatty liver disease severity.
19729411 2009 Genetic evidence for a role of adiponutrin in the metabolism of apolipoprotein B-containing lipoproteins.
19651814 2009 Dissociation between fatty liver and insulin resistance in humans carrying a variant of the patatin-like phospholipase 3 gene.
19619606 2009 Tri-iodothyronine upregulates adiponutrin mRNA expression in rat and human adipocytes.
19596471 2009 A single nucleotide polymorphism (SNP) rs2072907 in the adiponutrin gene (ADPN) was not associated with obesity and type 2 diabetes in Chinese population.
19542081 2010 A common variant in the adiponutrin gene influences liver enzyme values.
19524579 2009 Prediction of non-alcoholic fatty liver disease and liver fat using metabolic and genetic factors.
19390624 2009 Genetic variance in the adiponutrin gene family and childhood obesity.
19239840 2009 [Polymorphisms in adiponutrin gene and association to hepatic steatosis].
19224197 2009 A common variant in PNPLA3, which encodes adiponutrin, is associated with liver fat content in humans.
19029121 2009 Mammalian patatin domain containing proteins: a family with diverse lipolytic activities involved in multiple biological functions.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
18820647 2008 Genetic variation in PNPLA3 confers susceptibility to nonalcoholic fatty liver disease.
18728122 2008 Polymorphisms in the adiponutrin gene are associated with increased insulin secretion and obesity.
16799181 2006 Characterization of the human patatin-like phospholipase family.
16505250 2006 Variation in the adiponutrin gene influences its expression and associates with obesity.
16150821 2005 Expression, regulation, and triglyceride hydrolase activity of Adiponutrin family members.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15364929 2004 Identification, cloning, expression, and purification of three novel human calcium-independent phospholipase A2 family members possessing triacylglycerol lipase and acylglycerol transacylase activities.
15181042 2004 Adiponutrin: A new gene regulated by energy balance in human adipose tissue.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.