Property Summary

Ligand Count 196
NCBI Gene PubMed Count 63
PubMed Score 531.40
PubTator Score 350.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Peripheral T-cell lymphoma 25

Expression

  Differential Expression (17)

Disease log2 FC p
Atopic dermatitis 1.200 1.2e-04
Breast cancer 1.500 1.4e-09
breast carcinoma 1.100 2.6e-13
Chronic Lymphocytic Leukemia -1.154 2.6e-04
cutaneous lupus erythematosus 1.100 4.2e-03
ductal carcinoma in situ 1.200 1.4e-03
group 3 medulloblastoma -1.100 5.3e-03
interstitial cystitis 1.100 6.7e-03
invasive ductal carcinoma 1.500 3.7e-04
lung carcinoma -1.100 1.7e-07
osteosarcoma -2.258 1.5e-04
ovarian cancer 1.900 6.3e-04
pancreatic cancer 1.100 3.5e-04
primary pancreatic ductal adenocarcinoma 1.954 3.7e-03
psoriasis 1.800 3.0e-07
tuberculosis -2.000 2.0e-05
ulcerative colitis 1.100 4.5e-04

Gene RIF (32)

AA Sequence

MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVF      1 - 70
GFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPG     71 - 140
FSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQ    141 - 210
KLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA    211 - 280
SIPLPDKAS                                                                 281 - 289
//

Text Mined References (70)

PMID Year Title