Property Summary

NCBI Gene PubMed Count 40
PubMed Score 283.13
PubTator Score 172.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26900324 These data suggest that lowering of PNN levels in epithelial cells results in dramatic transformation in the number and composition of splicing variants and that PNN plays a crucial role in the selection of which RNA isoforms differentiating cells produce.
25489234 PNN has an important role in alternative splicing of a specific subset of lncRNAs of the corneal epithelium.
23299472 ESRP1 and PNN modulate alternative splicing of a specific subset of target genes, but not general splicing events, in HCET cells to maintain or enhance epithelial characteristics.
23097096 Urinary desmosine level is an important biologoical marker, in patients treated with bilateral knee replacement and hydrocortison therapy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18086895 Corepressor CtBP and PNN/DRS differentially modulate transcription and splicing of the E-cadherin gene.
16430868 Pnn may play a general role in the control of the cellular amount of family SR proteins through down-regulation of its own expression
15542832 the interaction of Pnn with the corepressor CtBP1 may modulate repression of E-cadherin transcription by CtBP1
14517304 Pnn may participate, via its interaction with RNPS1, in mRNA metabolism in the nucleus, including mRNA splicing and export
12051732 Pinin functions as a splicing regulator which participates itself directly in splicing reaction or indirectly via other components of splicing machinery

AA Sequence

MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGG      1 - 70
GPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATSKERTRRDLIQDQNMDEKGKQ     71 - 140
RNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLE    141 - 210
QKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINK    211 - 280
MEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAE    281 - 350
KEQEEEEQKQEMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVIADQEVMETNRVESVEPSENE    351 - 420
ASKELEPEMEFEIEPDKECKSLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQSQPQLQLQSQS    421 - 490
QPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEVPVEPVLTVHPESKSKTKTRS    491 - 560
RSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRDSSSSTSSSSE    561 - 630
SRSRSRGRGHNRDRKHRRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKR    631 - 700
SSRSERDRKSDRKDKRR                                                         701 - 717
//

Text Mined References (56)

PMID Year Title
26900324 2016 RNA-seq analysis of impact of PNN on gene expression and alternative splicing in corneal epithelial cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25489234 2014 Role of Pnn in alternative splicing of a specific subset of lncRNAs of the corneal epithelium.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23299472 2013 Transcriptomic analysis of PNN- and ESRP1-regulated alternative pre-mRNA splicing in human corneal epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097096 2012 Steroid modulation of cytokine release and desmosine levels in bilateral total knee replacement: a prospective, double-blind, randomized controlled trial.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22388736 2012 The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18086895 2008 Corepressor CtBP and nuclear speckle protein Pnn/DRS differentially modulate transcription and splicing of the E-cadherin gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16430868 2006 Loss of Pnn expression attenuates expression levels of SR family splicing factors and modulates alternative pre-mRNA splicing in vivo.
16341674 2005 Transcriptome analysis of human gastric cancer.
16314458 2005 Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core.
15735603 2005 Reduction of Pnn by RNAi induces loss of cell-cell adhesion between human corneal epithelial cells.
15542832 2004 Nuclear speckle-associated protein Pnn/DRS binds to the transcriptional corepressor CtBP and relieves CtBP-mediated repression of the E-cadherin gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358154 2004 Over-expression of SR-cyclophilin, an interaction partner of nuclear pinin, releases SR family splicing factors from nuclear speckles.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14729963 2004 Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14578391 2003 Pinin/DRS/memA interacts with SRp75, SRm300 and SRrp130 in corneal epithelial cells.
14517304 2003 Nuclear Pnn/DRS protein binds to spliced mRNPs and participates in mRNA processing and export via interaction with RNPS1.
12893261 2003 Molecular characterization of a novel nucleolar protein, pNO40.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077342 2002 Mammalian PRP4 kinase copurifies and interacts with components of both the U5 snRNP and the N-CoR deacetylase complexes.
12051732 2002 Modulation of alternative pre-mRNA splicing in vivo by pinin.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10809736 2000 Dissection of protein linkage between keratins and pinin, a protein with dual location at desmosome-intermediate filament complex and in the nucleus.
10645008 2000 Characterization of the gene encoding pinin/DRS/memA and evidence for its potential tumor suppressor function.
10486276 1999 Antibodies differentiate desmosome-form and nucleus-form pinin: evidence that pinin is a moonlighting protein with dual location at the desmosome and within the nucleus.
10095061 1999 memA/DRS, a putative mediator of multiprotein complexes, is overexpressed in the metastasizing human melanoma cell lines BLM and MV3.
9447706 1997 Evidence that "pinin", reportedly a differentiation-specific desmosomal protein, is actually a widespread nuclear protein.
8922384 1996 Characterization of pinin, a novel protein associated with the desmosome-intermediate filament complex.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.