Property Summary

Ligand Count 73
NCBI Gene PubMed Count 44
PubMed Score 857.60
PubTator Score 313.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-04
aldosterone-producing adenoma -1.427 2.8e-02
lung adenocarcinoma -2.900 7.6e-19
lung cancer 1.400 9.2e-04
malignant mesothelioma 2.300 1.7e-07
psoriasis -1.500 1.1e-14

PDB (41)

Gene RIF (41)

AA Sequence

MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV      1 - 70
SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW     71 - 140
QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH    141 - 210
LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV    211 - 280
GL                                                                        281 - 282
//

Text Mined References (49)

PMID Year Title