1. Home
  2. Targets
  3. storage protein
  4. esterase
  5. phospholipase
  6. Pancreatic lipase-related protein 2

Tbio Pancreatic lipase-related protein 2

Lipase with broad substrate specificity. Can hydrolyze both phospholipids and galactolipids. Acts preferentially on monoglycerides, phospholipids and galactolipids. Contributes to milk fat hydrolysis.

This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele. [provided by RefSeq, Aug 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 33.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -9.700 1.1e-10
intraductal papillary-mucinous carcinoma... -9.600 1.1e-10
intraductal papillary-mucinous neoplasm ... -9.600 1.9e-07
active Crohn's disease -1.579 4.6e-02
pancreatic cancer -3.700 1.1e-02
gastric carcinoma -2.600 3.5e-02
ulcerative colitis -1.600 4.1e-02
psoriasis -2.300 3.3e-10

Synonym

Accession P54317 A8K627 Q6IB55 PL-RP2
Symbols PLRP2

Gene

PNLIPRP2

PANTHER Protein Class (3)

PDB

2OXE   2PVS  

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 UniProt Keyword (12)

See all...

 GO Function (5)

 GO Component (2)

 GO Process (4)

 Compartment GO Term (0)

 MGI Phenotype (5)

 GWAS Trait (1)

Pathway (11)

See all...

Protein-protein Interaction (5)

EDC3   DCP1B   DCP1A   DDX6   TGFB1  

Gene RIF (11)

PMID Text
26494624 The beta5-Loop and Lid Domain Contribute to the Substrate Specificity of Pancreatic Lipase-related Protein 2
23732775 Pancreatic lipase-related protein 2 digests fats in human milk and formula in concert with gastric lipase and carboxyl ester lipase.
21865348 BSSL and PLRP2 hydrolyzed triglycerides (TG) to free FA and glycerol.
21652702 Pancreatic lipase-related protein-2 (PLRP2) can contribute to dietary fat digestion in human newborns
21554982 localization of PLRP2 in endosomes of monocytes
19548271 The pancreatic lipase related protein 2 is required for lipid-dependent cytotoxicity mediated by cytotoxic T lymphocytes.
18702514 Most of the structural and kinetic properties of HPLRP2 were found to be different from those of rat PLRP2
17401110 finding that the inhibition of nonproteolyzed rHPLRP2 by tetrahydrolipstatin and diethyl-p-nitrophenyl phosphate does not involve any bile salt requirements suggests that the rHPLRP2 lid adopts an open conformation in aqueous media.
16887271 Patients with chronic calcifying pancreatitis (CCP) had significantly lower levels of both pancreatic lipase and PLRP2 than the controls subjects.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15287741 Investigation of the substrate specificity of purified recombinant pancreatic lipase-related protein 2 reveals that its physiological role is digestion of galactolipids, the main plant lipids present in the vegetables which are a part of the human diet.

AA Sequence 

MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLI      1 - 70
TGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNI     71 - 140
RVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRL    141 - 210
DPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSC    211 - 280
NHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGE    281 - 350
SGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKF    351 - 420
LWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC                         421 - 469
//

Text Mined References (21)

PMID Year Title
26494624 2015 The ?5-Loop and Lid Domain Contribute to the Substrate Specificity of Pancreatic Lipase-related Protein 2 (PNLIPRP2).
23732775 2013 Pancreatic lipase-related protein 2 digests fats in human milk and formula in concert with gastric lipase and carboxyl ester lipase.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21865348 2011 BSSL and PLRP2: key enzymes for lipid digestion in the newborn examined using the Caco-2 cell line.
21652702 2011 Pancreatic lipase-related protein-2 (PLRP2) can contribute to dietary fat digestion in human newborns.
21554982 Bis (monoacylglycero) phosphate interfacial properties and lipolysis by pancreatic lipase-related protein 2, an enzyme present in THP-1 human monocytes.
20445095 2010 Colloquium paper: human adaptations to diet, subsistence, and ecoregion are due to subtle shifts in allele frequency.
20083229 2010 Lipolysis of natural long chain and synthetic medium chain galactolipids by pancreatic lipase-related protein 2.
19824014 2009 Individual and combined action of pancreatic lipase and pancreatic lipase-related proteins 1 and 2 on native versus homogenized milk fat globules.
19548271 2009 Lipid-dependent cytotoxicity by the lipase PLRP2 and by PLRP2-positive cytotoxic T lymphocytes (CTLs).
18702514 2008 Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
17401110 2007 Further biochemical characterization of human pancreatic lipase-related protein 2 expressed in yeast cells.
16887271 2006 Human pancreatic lipase-related protein 2: tissular localization along the digestive tract and quantification in pancreatic juice using a specific ELISA.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15287741 2004 Human pancreatic lipase-related protein 2 is a galactolipase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
1379598 1992 Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity.