Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.04
PubTator Score 7.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (2)

AA Sequence

MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYTNENPNNFQIL      1 - 70
LLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNCICVDWKKGSQATYTQAANNV     71 - 140
RVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPGLSRITGLDPVEASFESTPEEVRLD    141 - 210
PSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACN    211 - 280
HLRSYKYYLESILNPDGFAAYPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEA    281 - 350
SNFARWRYGVSITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW    351 - 420
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC                           421 - 467
//

Text Mined References (9)

PMID Year Title