Property Summary

NCBI Gene PubMed Count 41
PubMed Score 1937.07
PubTator Score 336.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Protein-protein Interaction (8)

Gene RIF (20)

PMID Text
25862608 Presence of methionine at position 221 in the PNLIP protein sequence causes protein misfolding and aggregation.
25239347 In patients with intraductal papillary mucinous neoplasm without a history of pancreatitis, serum pancreatic lipase and amylase outside normal range are associated with risk of malignancy.
24650780 All these findings support the use of YLLIP2 in enzyme replacement therapy for the treatment of pancreatic exocrine insufficiency, a pathological situation in which an acidification of intestinal contents occurs.
24262094 a novel mutation in the PNLIP gene in two brothers with congenital pancreatic lipase deficiency
23918603 Low PNLIP expression is associated with pancreatic cancer.
22393262 Triacylglycerol lipase and alpha-amylase are highly over-expressed in pancreatic cyst fluids in patients with mucinous pancreatic neoplasms.
20150178 Combination of two mutations with a promising one at the entrance of the catalytic cavity (K80E) negatively affected the lipase activity at neutral pH but not that at acidic pH.
20136147 the amplitude of the lid opening measured in solution or in a frozen solution in the presence of amphiphiles
19346257 Trp-107 and Trp-253 contribute to the change in steady state fluorescence that is triggered by mixed micelles of inhibitor and bile salt.
19113953 The disulfide bridge between the hinges of the lid kept the secondary structure of the lid intact, whereas the HPL was completely unfolded.
18353248 Introducing a negative charge close to the catalytic histidine induced a shift of the pH optimum toward acidic values but strongly reduced the lipase activity.
17269661 Electron paramagnetic resonance spectroscopy along with site-directed spin labeling was used to monitor the conformational changes in the human PL lid in solution to assess the effects of partners of the lipase, i.e. colipase and bile salts.
16431912 pancreatic lipase-colipase interactions in the presence of bile salt micelles are mediated by Val-407 and Ile-408 of PL
16385451 Observational study of gene-disease association. (HuGE Navigator)
16179352 analysis of a lid hydrophobicity pattern in pancreatic lipase
15316225 a specific method of measuring classical pancreatic lipase in human serum
14580194 examination of tryptophan changes in pancreatic lipase
12667003 analysis of human pancreatic lipase from pancreatic juice (BCR693) and a recombinant form (BCR694)
12369922 Review. The structure and function of the pancreatic lipase C2 domains, based on the recent 3D structures and improved sequence alignments are reviewed.
11393534 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVA      1 - 70
ADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRI     71 - 140
VGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDP    141 - 210
SDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNH    211 - 280
LRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDAS    281 - 350
NFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY    351 - 420
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC                             421 - 465
//

Text Mined References (43)

PMID Year Title
25862608 2015 A novel mutation in PNLIP causes pancreatic triglyceride lipase deficiency through protein misfolding.
25748441 2015 A broad pH range indicator-based spectrophotometric assay for true lipases using tributyrin and tricaprylin.
25239347 2014 Abnormal serum pancreatic enzymes, but not pancreatitis, are associated with an increased risk of malignancy in patients with intraductal papillary mucinous neoplasms.
24650780 2014 An interfacial and comparative in vitro study of gastrointestinal lipases and Yarrowia lipolytica LIP2 lipase, a candidate for enzyme replacement therapy.
24489884 2014 Genome-wide association study of proneness to anger.
24262094 2014 Identification of a novel mutation in the PNLIP gene in two brothers with congenital pancreatic lipase deficiency.
23918603 2013 Integration of metabolomics and transcriptomics revealed a fatty acid network exerting growth inhibitory effects in human pancreatic cancer.
22393262 2012 Glycomic and proteomic profiling of pancreatic cyst fluids identifies hyperfucosylated lactosamines on the N-linked glycans of overexpressed glycoproteins.
20150178 2010 Modification of pancreatic lipase properties by directed molecular evolution.
20136147 2010 Amplitude of pancreatic lipase lid opening in solution and identification of spin label conformational subensembles by combining continuous wave and pulsed EPR spectroscopy and molecular dynamics.
19346257 2009 Trp-107 and trp-253 account for the increased steady state fluorescence that accompanies the conformational change in human pancreatic triglyceride lipase induced by tetrahydrolipstatin and bile salt.
19113953 2009 Lid opening and unfolding in human pancreatic lipase at low pH revealed by site-directed spin labeling EPR and FTIR spectroscopy.
18353248 2008 Exploring the active site cavity of human pancreatic lipase.
17933690 2007 Pancreatic lipase inhibitors from natural sources: unexplored potential.
17269661 2007 Probing the opening of the pancreatic lipase lid using site-directed spin labeling and EPR spectroscopy.
16431912 2006 Val-407 and Ile-408 in the beta5'-loop of pancreatic lipase mediate lipase-colipase interactions in the presence of bile salt micelles.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16179352 2005 Role of the lid hydrophobicity pattern in pancreatic lipase activity.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15316225 2004 Critical evaluation of a specific ELISA and two enzymatic assays of pancreatic lipases in human sera.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580194 2003 Time-resolved fluorescence allows selective monitoring of Trp30 environmental changes in the seven-Trp-containing human pancreatic lipase.
12667003 2003 Preparation and characterization of reference materials for human pancreatic lipase: BCR 693 (from human pancreatic juice) and BCR 694 (recombinant).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12369922 2000 The C-terminal domain of pancreatic lipase: functional and structural analogies with c2 domains.
11393534 2001 Polymorphisms in PNLIP, encoding pancreatic lipase, and associations with metabolic traits.
11278590 2001 Colipase residues Glu64 and Arg65 are essential for normal lipase-mediated fat digestion in the presence of bile salt micelles.
10769148 2000 Hydrolysis of retinyl esters by pancreatic triglyceride lipase.
9631512 1998 Human pancreatic triglyceride lipase expressed in yeast cells: purification and characterization.
9240923 1997 Structure and function of pancreatic lipase and colipase.
8479519 1993 Interfacial activation of the lipase-procolipase complex by mixed micelles revealed by X-ray crystallography.
8406023 1993 The human pancreatic lipase-encoding gene: structure and conservation of an Alu sequence in the lipase gene family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8029213 1994 Structure-function relationships in naturally occurring mutants of pancreatic lipase.
7893686 1995 The 2.46 A resolution structure of the pancreatic lipase-colipase complex inhibited by a C11 alkyl phosphonate.
7601150 1995 Kinetics of the two-step hydrolysis of triacylglycerol by pancreatic lipases.
2479644 1989 Cloning and characterization of human pancreatic lipase cDNA.
2106079 1990 Structure of human pancreatic lipase.
1783385 1991 Assignment of human pancreatic lipase gene (PNLIP) to chromosome 10q24-q26.
1522902 1992 Structure of the pancreatic lipase-procolipase complex.
1379598 1992 Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity.