Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.88

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
psoriasis 6514 4.3e-24
group 3 medulloblastoma 4002 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Bipolar I disorder 23 4.524 2.3
Schizoaffective Disorder 55 4.184 2.1


  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.100 1.5e-03
psoriasis -2.700 4.3e-24

Gene RIF (4)

AA Sequence

HSPNVNCLLQVCGIVTAWALLAFILGRSGT                                            491 - 520

Text Mined References (10)

PMID Year Title