Property Summary

NCBI Gene PubMed Count 30
PubMed Score 92.32
PubTator Score 34.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.200 8.9e-05
malignant mesothelioma -1.200 8.7e-06
medulloblastoma, large-cell -1.300 4.9e-05
Multiple myeloma 1.336 1.1e-04
ovarian cancer 1.200 1.7e-04

Gene RIF (8)

AA Sequence

MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKE      1 - 70
AFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQ     71 - 140
RGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL                      141 - 192
//

Text Mined References (35)

PMID Year Title