Property Summary

NCBI Gene PubMed Count 19
PubMed Score 133.52
PubTator Score 38.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.800 8.5e-04
oligodendroglioma 2.200 1.8e-03
psoriasis -1.700 3.4e-04
posterior fossa group A ependymoma -3.100 1.6e-04
sonic hedgehog group medulloblastoma -5.800 3.4e-09
atypical teratoid/rhabdoid tumor -4.700 1.5e-06
medulloblastoma, large-cell -4.500 2.6e-06
interstitial cystitis 1.300 2.4e-02
adult high grade glioma 1.800 1.3e-04
pilocytic astrocytoma 2.000 1.4e-07
lung carcinoma 1.100 1.0e-07
Pick disease 1.100 1.5e-02
progressive supranuclear palsy -1.600 2.0e-02

Synonym

Accession P02689 Q6FHL4
Symbols P2
MP2
FABP8
M-FABP

Gene

PDB

2WUT   3NR3   4A1H   4A1Y   4A8Z   4BVM   4D6A   4D6B  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
26828946 This report might expand the genetic and clinical features of Charcot-Marie-Tooth disease and a further mechanism study will enhance our understanding of PMP2-associated peripheral neuropathy.
26527266 A fully deuterated sample of myelin P2 protein was produced identifying the neutron crystal structure.
24419389 The structure of human P2 refined at the ultrahigh resolution of 0.93 A allows detailed structural analyses, including the full organization of an internal hydrogen-bonding network.
20421974 the structure and function of the P2 protein from human myelin, which is able to bind both monomeric lipids inside its cavity and membrane surfaces

AA Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE      1 - 70
FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV             71 - 132
//

Text Mined References (21)

PMID Year Title
26828946 2016 A Mutation in PMP2 Causes Dominant Demyelinating Charcot-Marie-Tooth Neuropathy.
26527266 2015 Production, crystallization and neutron diffraction of fully deuterated human myelin peripheral membrane protein P2.
25416956 2014 A proteome-scale map of the human interactome network.
24419389 2014 Atomic resolution view into the structure-function relationships of the human myelin peripheral membrane protein P2.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20421974 2010 Structural and functional characterization of human peripheral nervous system myelin protein P2.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11241848 2001 Exonic SNPs at positions 220 (A/G) and 445 (C/T) of the peripheral myelin protein 2 (PMP2).
8288226 1993 Structure and localization of the gene encoding human peripheral myelin protein 2 (PMP2).
7525873 1994 Partial structure and mapping of the human myelin P2 protein gene.
6206203 1984 Ultrastructural localization of P2 protein in actively myelinating rat Schwann cells.
6183401 1982 The complete amino acid sequence of human P2 protein.
6172423 1982 The complete amino acid sequence of the rabbit P2 protein.
2458918 1988 The three-dimensional structure of P2 myelin protein.
2453513 1988 Characterization of a cloned cDNA encoding rabbit myelin P2 protein.
1720307 1991 Isolation and sequence determination of cDNA encoding P2 protein of human peripheral myelin.