Property Summary

NCBI Gene PubMed Count 20
PubMed Score 38.88
PubTator Score 15.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 4.6e-05
Barrett's esophagus -1.300 1.6e-02
esophageal adenocarcinoma -1.300 1.8e-02
group 4 medulloblastoma -1.100 7.4e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.2e-02
malignant mesothelioma -1.500 1.1e-06
medulloblastoma, large-cell -1.900 1.3e-05
ulcerative colitis -1.600 4.9e-08

 MGI Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (7)

AA Sequence

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVI      1 - 70
EKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISP     71 - 140
IGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSF    141 - 210
DTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA                      211 - 262
//

Text Mined References (21)

PMID Year Title