Property Summary

NCBI Gene PubMed Count 394
PubMed Score 345.22
PubTator Score 1267.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 2.000 5.1e-06
cutaneous lupus erythematosus 1.200 1.0e-03
osteosarcoma -1.385 1.1e-05
atypical teratoid / rhabdoid tumor 1.700 5.2e-08
medulloblastoma 1.300 9.8e-06
medulloblastoma, large-cell 1.600 2.1e-04
intraductal papillary-mucinous adenoma (... 1.200 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.0e-03
Multiple Sclerosis 1.600 2.1e-02
pediatric high grade glioma 1.300 3.1e-04
ulcerative colitis 1.100 1.1e-05
ovarian cancer 1.500 3.2e-12
head and neck cancer 1.100 1.3e-04

Gene RIF (297)

PMID Text
27052408 Data suggest that hematopoietically expressed homeobox protein (HHEX) downmodulation by promyelocytic leukemia-retinoic acid receptor alpha fusion oncoprotein (PML-RARalpha) is a key event during acute promyelocytic leukemia (APL) pathogenesis.
27030546 Suggest a novel role of PCGF2 in arsenic trioxide-mediated degradation of PML-RARA that PCGF2 might act as a negative regulator of UBE2I via direct interaction.
27000403 The authors show that PML can inhibit HIV-1 and other lentiviruses as part of the IFN-I-mediated response.
26728854 The results corroborated that PML-II plays a critical role in generating nuclear Lipid droplets in specific cell types.
26728337 Mutations affect both the rearranged and the unrearranged PML alleles in refractory acute promyelocytic leukaemia.
26703718 PML contributes to the intrinsic restriction of HIV-1 infections in a cell type-dependent manner.
26703467 Authors demonstrate leukemogenicity of PAX5-PML by introducing it into normal mouse pro-B cells; B-cell linker protein (Blnk) is repressed by PAX5-PML in leukemia cells; enforced expression of Blnk increases survival despite introduction of PAX5-PML.
26675234 The association of RNF168 with PML NBs resulted in increased ubiquitylation.
26578773 PML IV enhances global SUMO-1 conjugation, particularly that of p53, resulting in p53 stabilization and activation.
26566030 identifying Daxx as a broad cellular inhibitor of reverse-transcription. Altogether, these findings unravel a novel antiviral function for PML and PML nuclear body-associated protein Daxx
26559840 These data suggest that targeting PML by human herpesvirus 5 IE1 represents a strategy to antagonize both intrinsic and innate immune mechanisms.
26537301 Novel insight into the functional difference of acquired mutations of PML-RARA both in vitro and in the clinical setting.
26510911 Indicate the important role of PML/c-Myc axis in the maintenance of glioblastoma tumor stem cells. Arsenic trioxide disrupts glioma stem cells via promoting PML degradation to inhibit tumor growth.
26468536 Studies of the dynamics of the response of PML nuclear body components and IFI16 to invading herpes simplex virus 1 genomes demonstrated that human Daxx (hDaxx) and IFI16 respond more rapidly than PML.
26383972 The activity of the PML internal ribosome entry site is induced by TNFalpha in a manner that involves MNK1 activation.
26294332 The PML-region mutations were associated with response to Arsenic trioxide-based therapy (P < 0.0001), number of relapses (P = 0.001), and early relapse (P = 0.013) in acute promyelocytic leukemia patients.
26213848 Methylated arsenic metabolites bind to PML protein but do not induce cellular differentiation and PML-RARalpha protein degradation in acute promyelocytic leukemia.
26163631 Imatinib kinase inhibitor can restore PML function by inhibition of casein kinase 2.
26119943 Our work provides a novel view of the physiologic function of PML, which participates in telomeres surveillance in normal cells. Our data further imply that a diminished PML function may contribute to cell senescence, genomic instability and tumorigenesis
26088929 our findings challenge the predominant model in the field and we propose that PML/RARA initiates leukemia by subtly shifting cell fate decisions within the promyelocyte compartment.
26060329 Data suggest that small ubiquitin-related modifier protein SUMO1 modification of the promyelocytic leukemia protein (PML) RING domain promotes SUMO2 conjugation to Lys160.
26057166 PML, hDaxx and Sp100 primarily act as cellular restriction factors during lytic human cytomegalovirus replication and during the dynamic process of reactivation but do not serve as key determinants for the establishment of latency.
26049103 Report solubility shift and SUMOylaltion of promyelocytic leukemia (PML) protein in response to arsenic(III).
26041820 Data show that the tumor suppressor RASSF1A is a direct target of the PML/RARalpha-regulated microRNAs miR-181a/b cluster.
26026090 bortezomib impairs the UPS that controls normal protein homeostasis by causing excessive accumulation of PML-RARA augmenting ER stress and leading to acute promyelocytic leukemia cell death
25999785 PML is upregulated in obesity and liver steatosis.
25971581 Lower levels of PML is associated with gastric cancer.
25962098 The present study constitutes evidence that PML contributes to a cellular antiviral response and restricts Dengue virus, DENV-2 replication in human A549 cells.
25921172 PML mutations may not contribute to gastric adenocarcinoma development. Post-translational modifications or protein degradation might be mechanisms by which PML is not expressed in gastric tumors.
25908860 (PML) nuclear bodies (APBs) at telomeres promote telomere maintenance by inducing a DNA damage response in ALT-positive tumor cells through changing the telomeric chromatin state to trigger ATM phosphorylation.
25892518 Endogenous PML suppresses interleukin (IL)-6-induced gene expression as well as phosphorylation and transcriptional activation of STAT3 in hepatoma cells.
25891951 NACC1 can be modified by SUMO paralogues, and cooperates with promyelocytic leukemia protein.
25812002 results demonstrate that PML participates in type I interferon-induced ISG expression by regulating ISGF3, and that this regulation by PML is counteracted by HCMV IE1
25772236 Authors performed mutational analysis to define a PML interaction motif within the E1B-55K polypeptide. Results showed that E1B-55K/PML binding is not required for p53, Mre11 and Daxx interaction.
25733689 Data propose that PML-II protein isoform has a role in the induction of genes of the innate immune response by mediating transcriptional complex assembly at their promoters.
25497731 The crystal structures of SUMO1 bound to unphosphorylated and tetraphosphorylated PML-SUMO-interacting motifs peptides indicate that three phosphoserines directly contact specific positively charged residues of SUMO1.
25457157 The 5-year recurrence-free survival rate is significantly lower in PML-negative than in PML-positive gastrointestinal stromal tumor patients.
25419843 Data show that interaction between promyelocytic leukemia protein (PML) and microtubule-associated protein light chain 3 (LC3) contributes to cell growth inhibition function of PML.
25355412 Structural studies of the B-box 1 dimer of human promyelocytic leukemia protein.
25354534 PML was indispensable to IFN-alpha mediated human mesenchymal stromal cells senescence.
25293974 A novel pathway of PML degradation in ccRCC.
25275592 CDKN2D repression by PML/RARalpha disrupts both cell proliferation and differentiation in the pathogenesis of acute promyelocytic leukemia.
25231954 study identifies E6AP and PML as potential prognostic markers in localized prostate carcinoma and supports a role for E6AP in driving the downregulation or loss of PML expression in prostate carcinomas
25143485 JAK2 and MPL expression levels regulate megakaryocytic proliferation vs differentiation in both normal and pathological conditions, and that JAK2 chemical inhibitors could promote a paradoxical thrombocytosis when used at suboptimal doses.
25032863 SIRT1/SIRT5-mediated PML deacetylation plays a role in the regulation of cancer cell survival.
24943846 A novel antioxidative mechanism by which PML regulates cellular oxidant homeostasis by controlling complex II integrity and Nrf2 activity and identified PML as an indispensable mediator of SFN activity.
24938310 Data indicate that single-nucleotide polymorphisms (SNPs) distributing in not only lysyl oxidase-like 1 gene (LOXL1) but also TBC1 domain family member 21 protein (TBC1D21) and promyelocytic leukemia protein (PML).
24711541 PML-RARalpha cooperates with HIF-1alpha to activate a pro-leukemogenic program.
24615016 PML nuclear bodies specifically accumulate at Rad51/RPA-containing lesions and senescence-derived persistent DNA damage foci but are not essential in replicative senescence.
24586174 Our results add PML/TRIM19 to the growing list of TRIM proteins implicated in both intrinsic and innate immunity.
24548562 role of Promyelocytic Leukemia protein in cancer
24487962 PML degradation mechanism through Notch/Hey1-induced repression of the PML deubiquitinase USP11 involved in brain tumour pathogenesis
24407287 this study reports an interaction between promyelocytic leukemia protein and apoptosis-associated speck-like protein containing a caspase-activating recruitment domain (ASC).
24288198 we will summarize the current viewpoints on the regulation and biological significance of cPML and discuss the important questions that still need to be further answered.
24255919 PML4 is an important regulator of GATA-1 and participates in erythroid differention by enhancing GATA-1 trans-activation activity.
24101171 Our data indicate that PML regulates hMSCs as an inhibitor of cell proliferation but a promoter of osteogenic differentiation.
24089549 herpes simplex virus 1 ICP0 facilitate the degradation and dissociation of host PML and dissociation of Sp100 from ND10.
24038216 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBPalpha during granulocytic differentiation but repressed by PML-RARalpha in APL.
24009715 SATB1 and PML may play an important role in up regulating HLA class I expression in EBV+ cHL.
23770850 PML/RARalpha suppresses PU.1-dependent activation of the proteasome immunosubunits in acute promyelocytic leukemia.
23768491 PML binds to the latent HIV-1 promoter, which coincides with transcriptionally inactive facultative heterochromatic marks, notably H3K9me2, at the viral genome.
23620081 PML deficiency facilitates genomic instability and promotes HBsAg-related hepatocarcinogenesis, which also involves androgen and lipid metabolism.
23563092 PML IV can interact physically with nEGFR and represses the transcription of nEGFR target genes.
23542129 Transactivation of glucocorticoid receptor-interacting protein 1 transactivation was stimulated to a similar degree by promyelocytic leukemia protein.
23530056 Arkadia protein binds to polysumoylated PML protein and relocalizes to PML nuclear bodies in response to arsenic.
23492774 Activation of protein kinase CK2 attenuates FOXO3a functioning in a PML-dependent manner.
23448850 Studies indicate that initiation of leukemogenesis by PML-RARalpha occurs independently from DNA methylation.
23440206 a unique role for PML in mTOR and EGFR inhibitor resistance and provide a strong rationale for a combination therapeutic strategy to overcome it.
23430110 Tumor suppressor promyelocytic leukemia protein selectively activates NLRP3 inflammasome.
23221561 Authors conclude that several ND10 components, including Daxx, the promyelocytic leukemia (PML) protein, and Sp100 cooperate in an additive manner to regulate herpes simplex virus type 1 and human cytomegalovirus infection.
23220564 Downregulation of PML gene and its synergism with HPV infection may play an important role and may serve as a new marker for early diagnosis and therapeutic intervention for cervical carcinogenesis.
23219818 these findings suggest that PML is required for HCV production.
23135708 Coimmunoprecipitation assays showed that adenoviral oncogene E1A-13S preferentially interacts with only one (PML-II) of at least six nuclear human PML isoforms.
23092969 The PML mRNA expression levels in membrane samples, and the PML protein concentrations in aqueous humor and vitreous fluid samples were significantly lower in proliferative diabetic retinopathy patients than control patients.
23064710 detection of double-stranded polymerase chain reaction (PCR) products of PML/RARalpha fusion gene in acute promyelocytic leukemia (APL)
23007646 PML is required for efficient IFN-gamma-induced MHC II gene transcription through regulation of the class II transactivator (CIITA)
22982005 analysis of a cryptic PML-RARA translocation in a patient with acute promyelocytic leukemia [case report]
22947142 PML is an essential regulator of TNFalpha signaling, and together they synergistically regulate cell adhesion by engaging multiple molecular mechanisms.
22945642 These findings suggest that UHRF1 promotes the turnover of PML protein
22918509 Postulate that detection of PML cytoplasmic particles in patient fibroblasts could become a valuable marker for diagnosis of disease development in laminopathies.
22915647 PML-RARA rearrangement is associated with good response to therapy in acute myeloid leukemia.
22906876 results suggest that PML expression was positively associated with IL-6 expression in patients and was also related to tumor development and resistance to treatment in multiple myeloma.
22886304 PML expression in breast cancer correlated strikingly with reduced time to recurrence, a gene signature of poor prognosis, and activated PPAR signaling.
22875967 Herpes simplex virus 1 ICP0 has 2 distinct mechanisms of targeting PML: one dependent on SUMO modification and the other via SUMO-independent interaction with PML.I; conclude that the ICP0-PML.I interaction reflects a countermeasure to PML-related antiviral restriction
22773875 Contribution of the C-terminal regions of promyelocytic leukemia protein (PML) isoforms II and V to PML nuclear body formation.
22711534 As IL6 is induced in response to various viral and genotoxic stresses, this cytokine may regulate autocrine/paracrine induction of PML under these pathophysiological states
22589541 Data indicate that promyelocytic leukemia protein (PML) functions as a negative regulator in endothelial cell network formation and migration.
22573317 E4-ORF3 activity correlates with the inhibition of PML-mediated antiviral activity.
22498738 HK3 is: (1) directly activated by PU.1, (2) repressed by PML-RARA, and (3) functionally involved in neutrophil differentiation and cell viability of acute promyelocytic leukemia cells.
22406621 PIAS1 was essential for PML degradation in non-small cell lung carcinoma (NSCLC) cells, and PML and PIAS1 were inversely correlated in NSCLC cell lines and primary specimens.
22296450 The 15q24 microdeletion may thus represent the first genetic hit to initiate leukaemogenesis and implicates PML and SUMO3 as novel components of the leukaemogenic network in TMD/AMKL.
22237204 PML through its scaffold properties is able to control cell growth and survival at many different levels. (Review)
22155184 beta-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells.
22045732 Assembly of a PML nuclear body occurs through multiple pathways and induces telomere elongation.
22033920 a model in which Pin1 promotes PML degradation in an ERK2-dependent manner.
22022583 Loss of PML protein expression in gastric cancer cells contributes to increased IP-10 transcription.
21998700 a novel functional connection between PML and the homologous recombination-mediated repair machinery
21994459 The authors demonstrated that only isoform IV of PML interacted with encephalomyocarditis virus 3D polymerase (3Dpol) and sequestered it within nuclear bodies.
21934296 investigation of DNA breakpoints in PML-RARalpha V-form fusion transcripts in 7 Chinese acute promyelocytic leukemia patients (out of total of 134 APL patients); in 5 of these cases, the V-form transcripts were unique (i.e., not described previously)
21840486 study indicates that the KLHL20-mediated PML degradation and HIF-1alpha autoregulation play key roles in tumor progression
21832009 Neither Daxx nor PML, the main players of ND10-based immunity, are required for the block to viral gene expression in the S/G2 phase.
21803845 PML functions in apoptosis regulation and tumor suppression are mediated by direct interaction with Fas.
21752469 The MPL immunohistochemical expression may represent a new marker for differential diagnosis between essential thrombocythemia and pre-fibrotic stage primary myelofibrosis.
21678421 PML immunohistochemical results were correlated with prognosis and with radiological response to alkylating agents/antracycline-based first line therapy in soft tissue sarcoma.
21639834 PML interacts with WRN and regulates double-strand break repair in gamma-irradiation-induced DNA damage responses.
21613260 Data indicate that PML-RARA (PR)-WT in the soluble fraction was transferred to the insoluble fraction after treatment with AsO, but PR-B/L-mut was stably detected in fractions both with and without AsO.
21529941 PML-ADAMTS17-RARA gene rearrangement is associated with pregnancy-related acute promyelocytic leukemia.
21489587 UL35 bodies form independently of PML and subsequently recruit PML, Sp100 and Daxx.
21430051 These findings demonstrate that Us3 orthologues derived from distantly related alphaherpesviruses cause a disruption of PML protein nuclear bodies in a kinase- and proteasome-dependent manner but, do not target PML for degradation.
21364283 physiologic PML-RARA expression was sufficient to direct a hematopoietic progenitor self-renewal program in vitro and in vivo
21310922 Depletion of S100A10 by RNA interference effectively blocked the enhanced fibrinolytic activity observed after induction of the PML-RAR-alpha oncoprotein
21305000 Silencing of USP7 was found to increase the number of PML-NBs, to increase the levels of PML protein and to inhibit PML polyubiquitylation in nasopharyngeal carcinoma cells
21304940 The efficient sequestration of virion capsids in PML cages appears to be the outcome of a basic cytoprotective function of this distinctive category of PML-NBs in sensing and safely containing nuclear aggregates of aberrant proteins.
21304169 The antiviral functions of PML-nuclear bodies are inactivated through reorganization during normalBK virus infection.
21245861 New insights that arose from these studies, in particular focussing on newly identified PML-RARalpha target genes, its interplay with RXR and deregulation of epigenetic modifications.
21240990 the clinicopathological associations and prognostic implications of promyelocytic leukemia gene (PML) expressions in patients with esophageal squamous cell carcinomas
21217775 data suggest the possible involvement of this fusion protein in the leukemogenesis of B-ALL in a dual dominant-negative manner and the possibility that ALL with PAX5-PML can be treated with ATO
21205865 the mechanism by which PML induces a permanent cell cycle exit and activates p53 and senescence
21198351 PML is induced by interferon, leading to a marked increase of expression of PML isoforms and the number of PML nuclear bodies [Review]
21192925 These results suggest that SUMO interaction motif-mediated HIPK2 targeting to PML-NBs is crucial for HIPK2-mediated p53 activation and induction of apoptosis.
21187718 Autophagy regulates myeloid cell differentiation by p62/SQSTM1-mediated degradation of PML-RARalpha oncoprotein
21172801 PML isoforms I and II participate in PML-dependent restriction of HSV-1 replication.
21161613 Recent literature on the role of PML in the central nervous system.
21115099 PML functions as a positive regulator of IFNgamma signaling
21092142 The study emphasizes a role of the variable C-terminus in subcellular target selection and a general role of the N-terminal tripartite motif domain in promoting protein clustering.
21057547 found that dominant-negative mutants of PML blocked AXIN-induced p53 activation, and that AXIN promotes PML sumoylation, a modification necessary for PML functions
21042751 Suppression of telomerase could activate the PML-dependent p53 signaling pathway and inhibit bladder cancer cell growth.
21037079 Pilocytic astrocytomas have telomere-associated promyelocytic leukemia bodies without alternatively lengthened telomeres.
20972455 have demonstrated that the lymphoid leukemia-associated protein, PAX5-PML chimeric oncogenic protein, could bind to PAX5 response-element as homodimer to inhibit the transactivation of PAX5 target-genes
20826694 SUMOylation promotes PML degradation during encephalomyocarditis virus infection.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20719947 an interaction between EBNA1 and the host CK2 kinase is crucial for EBNA1 to disrupt PML bodies and degrade PML proteins
20699642 Upregulation of the PML tumor suppressor in cellular senescence triggered by diverse drugs including clinically used anti-cancer chemotherapeutics relies on stimulation of PML transcription by JAK/STAT-mediated signaling.
20639899 results together with earlier work are consistent with the idea that SUMOylation regulates targeting of E1B-55K to PML-containing subnuclear structures, known to control transcriptional regulation, tumour suppression, DNA repair and apoptosis
20625391 Data show that the CSNK2A1P gene is a functional proto-oncogene in human cancers and its functional polymorphism appears to degrade PML differentially in cancer cells.
20578240 Data describe differences in promyelocytic leukemia protein expression between different types of soft tissue sarcoma and the corresponding normal surrounding tissue.
20574048 autophagic degradation contributes significantly both to the basal turnover as well as the therapy-induced proteolysis of PML/RARA
20544846 PML breakpoints are associated with acute promyelocytic leukemia.
20501696 MORC3 colocalizes with PML by a two-step molecular mechanism.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20228380 Promyelocytic leukemia protein (PML) was immunolocalized within nuclei of villus mesenchyme, but largely absent in trophoblast nuclei, with a trend for increased PML reactivity in preeclamptic placenta.
20198315 Observational study of gene-disease association. (HuGE Navigator)
20181954 SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress.
20159610 Selective targeting of PU.1-regulated genes by PML/RARalpha is a critical mechanism for the pathogenesis of acute promyelocytic leukemia(APL).
20159609 PML-RARalpha/RXR functions as a local chromatin modulator and that specific recruitment of histone deacetylase activities to genes important for hematopoietic differentiation, RAR signaling, and epigenetic control is crucial to its transforming potential.
20155840 We studied 21 PML-RARA positive/RARA-PML negative cases by bubble PCR and multiplex long template PCR to identify the genomic breakpoints.
20133893 Patients with decreased expression of PML protein have higher adverse clinical features in a subgroup of acute promyelocytic leukemia.
20133705 PML/RARalpha transactivates the TF promoter through an indirect interaction with an element composed of a GAGC motif and the flanking nucleotides, independent of AP-1 binding.
20130140 During interphase PML-NBs adopt a spherical organization characterized by the assembly of PML and Sp100 proteins into patches within a 50- to 100-nm-thick shell.
20123968 Data show that the major histocompatibility complex class II gene DRA is relocated to promyelocytic leukemia (PML) nuclear bodies upon induction with IFN-gamma, and this topology is maintained long after transcription shut off.
20100838 Promyelocytic leukemia protein controls cell migration in response to hydrogen peroxide and insulin-like growth factor-1
19865110 PML-RARalpha ligand-binding domain deletion mutations associated with reduced disease control and outcome after first relapse of acute promyelocytic leukemia.
19863682 alternative splicing of PML/RARalpha transcripts might be involved in nonsense-mediated decay
19861416 Novel nuclear nesprin-2 variants tether active extracellular signal-regulated MAPK1 and MAPK2 at promyelocytic leukemia protein nuclear bodies and act to regulate smooth muscle cell proliferation.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19808906 PML in PML-NBs links the DNA damage response with HBV replication and may cooperate with HBV-core and HDAC1 on the HBV circular DNA basal core promoter to form a positive feedback loop for HBV exacerbation during chemotherapy and radiotherapy.
19750561 PML, TopBP1, NBS1 or ATM-induced activation of phosphorylation of Chk2 participates in the DNA damage-elicited pro-apoptotic cascade that leads to the demise of Env-elicited syncytia
19728758 Frequency of the c.2260G>C (p.Ala754Pro) variant in isoform IV of the PML gene was higher in patients with colon polyposis and cancer
19703418 this is the first report of the variable susceptibility of influenza A virus subtypes/strains to human PML proteins.
19597475 PML was found to be important for E1A-induced suppression of EGFR and subsequent killing of head and neck squamous cell carcinoma cells suggesting a novel pathway involving PML and p73 in the regulation of EGFR expression.
19553342 The authors demonstrate that LANA2 relieves PML-mediated transcriptional repression of survivin, a protein that directly contributes to malignant progression of primary effusion lymphoma cells.
19487292 In the context of mutant p53, PML enhances its cancer-promoting activities.
19380586 sumoylation- and Sumo binding domain-dependent PML oligomerization within nuclear bodies is sufficient for RNF4-mediated PML degradation
19339552 Results provide insight into a dynamic pool of cytoplasmic nucleoporins that form a complex with the tumor suppressor protein PML during the G1 phase of the cell cycle.
19322209 Knock-in human PML-RARalpha alone can confer properties of self-renewal to committed murine hematopoietic progenitors before the onset of disease.
19224461 We report three of 40 diagnosed APL cases that showed morphological, cytochemical, and immunophenotypic features of hypergranular APL, but did not show a PML/RARalpha fusion signal or any of its variants, on FISH.
19177012 PML, TopBP1, NBS1 or ATM-induced activation of phosphorylation of Chk2 participates in the DNA damage-elicited pro-apoptotic cascade that leads to the demise of Env-elicited syncytia
19164952 PML, TopBP1, NBS1 or ATM-induced activation of phosphorylation of Chk2 participates in the DNA damage-elicited pro-apoptotic cascade that leads to the demise of Env-elicited syncytia
19150978 The physical interaction between PML3 and TIP60 protects TIP60 from Mdm2-mediated degradation, suggesting that PML3 competes with MDM2 for binding to TIP60.
19111660 The existence of a proapoptotic autoregulatory feedback loop between p73, YAP, and the promyelocytic leukemia (PML) tumor suppressor gene, is shown.
19100514 Acute promyelocytic leukemia with insertion of PML exon 7a and partial deletion of exon 3 of RARA is reported.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19029980 whereas transcriptional activation of PML-RARA is likely to control differentiation, its catabolism triggers leukemia-initiating cell eradication and long-term remission of mouse acute promyelocytic leukemia
19023333 Promyelomonocytic leukemia activation is a critical early event that participates in the apoptotic demise of HIV-1-elicited syncytia.
19023333 PML, TopBP1, NBS1 or ATM-induced activation of phosphorylation of Chk2 participates in the DNA damage-elicited pro-apoptotic cascade that leads to the demise of Env-elicited syncytia
19015637 DNA damage-induced PML SUMOylation and are required for the ability of PML to cooperate with HIPK2 for the induction of cell death.
18945770 The results indicate that both sets of events mediated by ICP0, the degradation of PML and the blocking of silencing via the HDAC1/2-CoREST-REST complex, are interdependent and in large measure dependent on events in the ND10 nuclear bodies.
18856066 the increase of level of survivin in tumor tissues is not the result of decrease in content of its inhibitors SMAC and PML, as their content in tumor and normal cells is the same.
18833293 PML disruption by EBNA1 requires binding to the cellular ubiquitin specific protease, USP7 or HAUSP, but is independent of p53.
18812519 Reduced PML Protein Expression Is associated with glioblastoma.
18809579 purified the PML complex and identified Fbxo3 (Fbx3), Skp1, and Cullin1 as novel components amd role in transcriptional regulation and leukemogenesis
18755984 In a series of human AMKL samples from both Down syndrome and non-Down syndrome patients, mutations were identified within KIT, FLT3, JAK2, JAK3, and MPL genes, with a higher frequency in DS than in non-DS patients.
18716620 results delineate a previously unknown PML-DAXX-HAUSP molecular network controlling PTEN deubiquitinylation and trafficking, which is perturbed by oncogenic cues in human cancer
18689862 PML is a novel prognostic tool for ampullary cancer patients.
18664490 A kinetics model for factor exchange at PML NBs and highlight potential mechanisms to regulate intranuclear trafficking of specific factors at these domains.
18636556 PML/RARalpha fusion protein mediates the unique sensitivity to arsenic cytotoxicity in acute promyelocytic leukemia cells.
18625722 These results demonstrate a novel function of HDAC7 and provide a regulatory mechanism of PML sumoylation.
18621739 PML is involved in trichostatin A-induced apoptosis
18566754 These data identify a key post-translational mechanism that controls PML protein levels in cancer cells and suggest that CK2 inhibitors may be beneficial anti-cancer drugs.
18511908 PCTA defines a new component of the TGF-beta signalling pathway that functions to facilitate Smad2 phosphorylation through controlling the accumulation of cPML into the cytoplasm, and consequently, the assembly of Smad2-receptor complex.
18480450 reorganization of the PML nuclear body by E4 ORF3 antagonizes an innate antiviral response mediated by both PML and Daxx.
18463162 PML sequesters HDAC7 to relieve repression and up-regulate gene expression
18298799 Over-expression of PML-2KA mutant in the cytoplasm, which was generated by mutagenesis of the nuclear localization signals of PML, in MCF-7 breast cancer cells suppressed PKM2 activity and the accumulation of lactate.
18246126 following DNA damage, PML facilitates Thr18 phosphorylation by recruiting p53 and CK1 into PML nuclear bodies, thereby protecting p53 from inhibition by Mdm2, leading to p53 activation.
18246125 Unexpected coupling of PML with NFAT reveals a novel mechanism underlying the diverse physiological functions of promyelocytic leukemia.
18160400 the Hes6-CBP complex in PML-NB may influence the proliferation of cells via p53-dependent and -independent pathways.
18158568 Overexpression of PML was associated with poor survival in gallbladder carcinomas.
18056407 In alternative lengthening of telomere cells, TRF2 inactivation/silencing triggers cellular senescence and substantial loss of telomeric DNA upon stable TRF2 knockdown.
18039859 Binding to Pin1 results in degradation of PML in a phosphorylation-dependent manner. Degradation of PML due to Pin1 acts both to protect a breast cancer tumor cell line from hydrogen peroxide-induced death and to increase the rate of proliferation.
18024792 The transcription factor PML-RARalpha regulates key cancer-related genes and pathways by inducing a repressed chromatin formation on its direct genomic target genes.
17996922 Endogenous WRN and BLM proteins localize in nucleoli and in nuclear PML bodies defined by isoforms of the PML protein, which is a key regulator of cellular senescence.
17991421 These results would shed new insights for the molecular mechanisms of PML-RARalpha-associated leukemogenesis.
17960172 The presence of a single PML-RARA isoform with exon 5 is associated with recurrence in acute promyelocytic leukemia
17943164 PML/RAR gene cytogenetic abnormalities in APL
17942542 promyelocytic leukemia protein (PML) and hDaxx, mediate an intrinsic immune response against HCMV infection by contributing independently to the silencing of HCMV IE gene expression.
17878236 Only two specific PML splice variants (PML-I and PML-IV) are efficiently targeted to the nucleolus and the abundant PML-I isoform is required for the targeting of endogenous PML proteins to this organelle.
17822314 Downregulation of the PML protein is associated with breast cancers
17767548 expression of proto-oncogene PML and HLA class I molecules were concordantly upregulated in hepatocellular carcinoma (HCC) and the expression of PML gene might be one of the mechanisms that leads to the increased expression of class I antigen in HCC
17562868 The type IV isoform of PML interacted with PU.1, promoted its association with p300, and then enhanced PU.1-induced transcription and granulocytic differentiation and PU.1 directly activates the transcription of the C/EBPepsilon gene.
17543368 Study recapitulated the effect of PML on early steps in infection by papillomavirus, it was found that replication and transcription of transfected paillomaviral genomes were not dependent on PML.
17475621 the hormone-independent association between PML-RARalpha and coactivators contributes to its ability to regulate gene expression
17441430 PML may play a role in cancer repression but not in cancer metastasis in laryngocarcinoma and nasopharyngeal carcinoma.
17428679 PML may be involved in nucleolar functions of normal non-transformed or senescent cells. The absence of nucleolar PML compartment in rapidly growing tumor cells suggests that PML association with the nucleolus might be important for cell-cycle regulation.
17419608 Results demonstrate that the gamma 1 isoform of phospholipase C associates with nuclear promyelocytic leukemia protein.
17360386 The increased expression of SUMO-1 in rheumatoid arthritis (RA) synovial fibroblasts (SFs) contributes to the resistance of these cells against Fas-induced apoptosis through increased SUMOylation of nuclear PML protein.
17173041 Our studies identify PML and SATB1 as a regulatory complex that governs transcription by orchestrating dynamic chromatin-loop architecture.
17172828 the role of PML cytoplasmic proteins in the regulation of p53.
17146439 establish PML-mediated destabilization of Myc and the derepression of cell cycle inhibitor genes as an important regulatory mechanism that allows cell differentiation
17062732 Histone deacetylase inhibitors blocked the increase of PML nuclear body number and suppressed up-regulation of PML mRNA and protein levels in several human cell lines and in normal diploid skin fibroblasts
17030982 PML nuclear bodies increase in number following DNA damage and this response is regulated by NBS1 as well as the kinases ATM, Chk2 and ATR.
17027752 SUMO-1, PML and ZNF198 colocalize to punctate structures, shown by immunocytochemistry to be PML bodies.
16935935 In response to ATRA, PML/RARalpha is dissociated from CAK, leading to MAT1 degradation, G1 arrest, and decreased CAK phosphorylation of PML/RARalpha
16924230 apoptin interacts directly with the promyelocytic leukemia protein (PML) in tumor cells and accumulates in PML nuclear bodies
16916642 The interaction of TGIF with cPML through c-Jun may negatively regulate TGF-beta signaling through controlling the localization of cPML and, consequently, the assembly of the cPML-SARA complex.
16912307 Our results provide evidence of how poliovirus counteracts p53 antiviral activity by regulating PML and NBs, thus leading to p53 degradation.
16873257 PML functions as part of an intrinsic immune mechanism against cytomegalovirus infections.
16873256 PML contributes to a cellular antiviral repression mechanism that is countered by the activity of ICP0.
16818720 We show that expression of PML isoform IV leads to formation of distinct nuclear bodies enriched in components of the ubiquitin-proteasome system. These bodies recruit soluble mutant ataxin-7 and promote its degradation preventing aggregate formation
16797070 The PML-RARA fusions can be identified by molecular analyses such as reverse transcriptase-polymerase chain reaction (PCR) and fluorescence in situ hybridization (FISH).
16630218 frequencies of the PML-RARalpha transcripts and subtypes in a series of 32 APL patients from Northeast Brazil
16540467 analysis of cytoplasmic function of mutant promyelocytic leukemia (PML) and PML-retinoic acid receptor-alpha
16501610 PML stimulated hSUMO-1 modification in yeast, in a manner that was dependent upon PML's RING-finger domain. PML:RARalpha also stimulated hSUMO-1 conjugation in yeast.
16501113 Interaction between Adenovirus type 5 E4 Orf3 and PML isoform II is necessary for nuclear domain 10 (ND10) rearrangement to occur
16449642 permanent transcriptional silencing is mediated by the association of PML-RAR with chromatin-modifying enzymes and by recruitment of the histone methyltransferase SUV39H1, responsible for trimethylation of lysine 9 of histone H3
16432238 PML-RARalpha functions by recruiting an HDAC3-MBD1 complex that contributes to the establishment and maintenance of the silenced chromatin state
16307818 Our work implies that the balance of promyelocytic leukemia protein and Epstein-Barr virus BZLF1 levels in cells may affect how each protein functions.
16154611 These results indicate that PML isoforms which are expressed in a serum-dependent manner suppress the propagation of influenza virus at an early stage of infection.
16113082 loss of one copy of PU.1 through deletion, plus down-regulation of the residual allele caused by PML-RARalpha expression, synergizes to expand myeloid progenitors susceptible to transformation, increasing the penetrance of acute promyelocytic leukemia
16007146 findings strengthen the relevance of the cross talk between PML and the p53 family members, imply a new tumour suppressive function of PML and unveil a possible role for PML in epidermal morphogenesis and differentiation
15968309 Observational study of genetic testing. (HuGE Navigator)
15922731 Isoforms of PML protein differ in their effects on ND10 organization.
15855159 IEX-1 is organized in subnuclear structures and partially co-localizes with promyelocytic leukemia protein in HeLa cells
15809060 inhibition of monocyte differentiation all contribute to the oncogenic activity of PML-RARalpha
15749021 PML3 has a direct role in the control of centrosome duplication through suppression of Aurora A activation to prevent centrosome reduplication
15746941 CDDO-Im downregulates PML expression in acute promyleocytic leukemic cells.
15601827 PML-retinoic acid receptor alpha activities are regulated by neutrophil elastase in early myeloid cells
15589835 INI1 is dispensable for retrovirus-induced cytoplasmic accumulation of PML and does not interfere with virus integration.
15569683 SUMO-1 functions to tether proteins to PML-containing nuclear bodies through post-translational modification and noncovalent protein-protein interaction
15467728 PML bodies control the distribution, dynamics and function of CHFR
15459016 TRAILprotein is a novel downstream transcriptional target of PML.
15359634 The 3 breakpoint cluster regions in the PML gene [Intron 6 (bcr1), exon 6 (bcr2) or intron 3 (bcr3)] were studied in 43 Mexican Mestizo APL patients. Bcr1=62.7%, bcr2=9.3% & bcr3=27.9%. Bcr1 was more prevalent than in Caucasians but similar to Asians.
15331439 PML I could act as a mediator for acute myeloid leukemia1 and its coactivator p300/CBP to assemble into functional complexes; a specific isoform PML I forms a complex with AML1
15273249 PML is a negative regulator of p38 kinase in tumor cells
15184504 PML plays a crucial role in modulating p73 function.
15163746 interference by human Cytomegalovirus IE1 protein with both the sumoylation of PML and its repressor activity requires a physical interaction with PML that also leads to disruption of PML oncogenic domains (PODs).
15096541 acute promyelocytic leukemia cell differentiation parallels transcriptional activation through PML-RARA-RXR oligomers
15060166 Results demonstrate that transcription activity associated with PML bodies is selectively repressed by the recruitment of Bach2 around PML bodies
14992722 PML is a direct p53 target that modulates p53 effector functions.
14970276 PML protein expression is frequently lost in human cancers of various histologic origins, and its loss associates with tumor grade and progression in some tumor histotypes
14970191 Data suggest that promyelocytic leukemia (PML) bodies form in nuclear compartments of high transcriptional activity, but they do not directly regulate transcription of genes in these compartments.
14715247 Together our results suggest that PML may suppress prostate cancer cell growth by inhibiting AR transactivation and/or enhancing p53 activity.
14663483 PML and the PML-NB act as molecular hubs for the induction and/or reinforcement of programmed cell death through a selective and dynamic regulation of proapoptotic transcriptional events.
14630830 DNA sequence variations resulting in a truncated PML protein was identified in acute promyelocytic leukemia cases that displayed retinoic acid resistance and a very poor prognosis
14597990 The ectopic expression of the acute promyelocytic leukemia-specific PML/RARalpha oncoprotein in U-937 cells results in induction of TF mRNA and promoter activity
14597622 PML-induced apoptosis by down-regulation of Survivin.
14534537 Leukemia-associated translocation products able to activate RAS modify PML and render cells sensitive to arsenic-induced apoptosis.
14528266 Results suggest that adenovirus type 5 has evolved a unique strategy that leads to the sustained neutralization of promyelocytic leukaemia protein bodies throughout infection, thereby ensuring optimal viral proliferation.
14526201 alternative splicing and role implicated in interaction with HIV-1
12917339 We show here that ZIPK is present in PODs, where it colocalizes with and binds to proapoptotic protein Daxx.
12907596 PML is required for homeodomain-interacting protein kinase 2 (HIPK2)-mediated p53 phosphorylation and cell cycle arrest but is dispensable for the formation of HIPK domains.
12837286 PML protein colocalizes and interacts with RFN36.
12810724 PML recruits Chk2 and p53 into the PML nuclear bodies and enhances p53/Chk2 interaction
12773567 PML regulates TopBP1 functions by association and stabilization of the protein in response to IR-induced DNA damage
12727882 role of interaction in recruiting cyclin T1 to nuclear bodies
12727882 PML, TopBP1, NBS1 or ATM-induced activation of phosphorylation of Chk2 participates in the DNA damage-elicited pro-apoptotic cascade that leads to the demise of Env-elicited syncytia
12647219 findings strongly suggest that increased promyelocytic leukemia protein expression is associated with growth inhibition and differentiation of human neuroblastoma cells
12610143 herpes simplex virus type 1 ICP4 is recruited into foci juxtaposed to ND10 (PML) in live, infected cells
12595526 Promyelocytic leukemia protein (PML) functions as a glucocorticoid receptor co-activator by sequestering Daxx to the PML oncogenic domains (PODs) to enhance its transactivation potential.
12540841 PML induces apoptosis through repression of the NF-kappaB survival pathway.
12506025 In human cell lines, PML is not involved directly in the regulation of MHC class I expression.
12506013 PML inhibited STAT3 activity in NIH3T3, 293T, HepG2, and 32D cells. PML formed a complex with STAT3 through B-box and COOH terminal regions in vitro and in vivo, thereby inhibiting its DNA binding activity.
12505266 Cryptic translocation of PML/RARA on 17q. A rare event in acute promyelocytic leukemia.
12438698 Purified RINGs, including PML, self-assemble into supramolecular structures in vitro that resemble those they form in cells. Self-assembly controls and amplifies reduction of 5' mRNA cap affinity of eIF4E by PML.
12419228 SUMO-1 protease-1 regulates gene transcription through PML
12402044 PML-dependent apoptosis after DNA damage is regulated by the checkpoint kinase hCds1/Chk2
12384561 PML is a target gene of beta-catenin and plakoglobin, and coactivates beta-catenin-mediated transcription.
12186918 PML does not affect herpes simplex virus 1 replication or the changes in the localization of ICP0 through infection
12167712 PML is a key stress-responsive regulator of eIF4E mRNA-dependent transport. PML inhibition of eIF4E depends on its association with the eIF4E nuclear body.
12093737 Of seven known PML isoforms, only PML IV is capable of causing premature senescence in PML +/+ murine and human primary fibroblasts but not in PML -/- murine cells, providing the first evidence for functional differences among these isoforms.
12080044 represses A20-mediated transcription.
12060771 induced PML in a mouse model
12032831 Promyelocytic leukemia protein PML inhibits Nur77-mediated transcription through specific functional interactions.
12032336 variant-type PML-RAR(alpha) fusion transcript in acute promyelocytic leukemia
12006491 antagonized by SIR2
11907221 contributes to innate immunity, defining host susceptibility to viral infections and immunopathology
11891284 UBE1L is a retinoid target that triggers PML/RARalpha degradation and apoptosis in acute promyelocytic leukemia
11430827 PML, TopBP1, NBS1 or ATM-induced activation of phosphorylation of Chk2 participates in the DNA damage-elicited pro-apoptotic cascade that leads to the demise of Env-elicited syncytia

AA Sequence

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL      1 - 70
PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC     71 - 140
FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP    141 - 210
LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR    211 - 280
ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG    281 - 350
FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE    351 - 420
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIK    421 - 490
MESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVIS    491 - 560
SSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAV    561 - 630
NRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEF    631 - 700
QEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVY    701 - 770
PFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA    771 - 840
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS                                841 - 882
//

Text Mined References (418)

PMID Year Title
27052408 2016 PML-RAR alpha induces the downmodulation of HHEX: a key event responsible for the induction of an angiogenetic response.
27030546 2016 PCGF2 negatively regulates arsenic trioxide-induced PML-RARA protein degradation via UBE2I inhibition in NB4 cells.
27000403 2016 The interferon-induced antiviral protein PML (TRIM19) promotes the restriction and transcriptional silencing of lentiviruses in a context-specific, isoform-specific fashion.
26728854 2016 PML isoform II plays a critical role in nuclear lipid droplet formation.
26728337 2016 Mutations affecting both the rearranged and the unrearranged PML alleles in refractory acute promyelocytic leukaemia.
26703718 2015 TRIM19/PML Restricts HIV Infection in a Cell Type-Dependent Manner.
26703467 2016 B Cell Linker Protein (BLNK) Is a Selective Target of Repression by PAX5-PML Protein in the Differentiation Block That Leads to the Development of Acute Lymphoblastic Leukemia.
26675234 2016 Identification of RNF168 as a PML nuclear body regulator.
26578773 2015 PML IV/ARF interaction enhances p53 SUMO-1 conjugation, activation, and senescence.
26566030 2015 PML/TRIM19-Dependent Inhibition of Retroviral Reverse-Transcription by Daxx.
26559840 2015 Characterization of Recombinant Human Cytomegaloviruses Encoding IE1 Mutants L174P and 1-382 Reveals that Viral Targeting of PML Bodies Perturbs both Intrinsic and Innate Immune Responses.
26537301 2016 Varying responses of PML-RARA with different genetic mutations to arsenic trioxide.
26510911 2015 Arsenic trioxide disrupts glioma stem cells via promoting PML degradation to inhibit tumor growth.
26468536 2015 Dynamic Response of IFI16 and Promyelocytic Leukemia Nuclear Body Components to Herpes Simplex Virus 1 Infection.
26383972 2016 Translational control of PML contributes to TNF?-induced apoptosis of MCF7 breast cancer cells and decreased angiogenesis in HUVECs.
26294332 2015 Evaluating frequency of PML-RARA mutations and conferring resistance to arsenic trioxide-based therapy in relapsed acute promyelocytic leukemia patients.
26213848 2015 Methylated arsenic metabolites bind to PML protein but do not induce cellular differentiation and PML-RAR? protein degradation.
26163631 2015 In Silico Interaction and Docking Studies Indicate a New Mechanism for PML Dysfunction in Gastric Cancer and Suggest Imatinib as a Drug to Restore Function.
26119943 2016 PML is required for telomere stability in non-neoplastic human cells.
26088929 2015 Transcription and methylation analyses of preleukemic promyelocytes indicate a dual role for PML/RARA in leukemia initiation.
26060329 2015 SUMO deconjugation is required for arsenic-triggered ubiquitylation of PML.
26057166 2015 Contribution of the Major ND10 Proteins PML, hDaxx and Sp100 to the Regulation of Human Cytomegalovirus Latency and Lytic Replication in the Monocytic Cell Line THP-1.
26049103 2015 Solubility shift and SUMOylaltion of promyelocytic leukemia (PML) protein in response to arsenic(III) and fate of the SUMOylated PML.
26041820 2015 PML/RAR?-Regulated miR-181a/b Cluster Targets the Tumor Suppressor RASSF1A in Acute Promyelocytic Leukemia.
26026090 2015 Bortezomib Causes ER Stress-related Death of Acute Promyelocytic Leukemia Cells Through Excessive Accumulation of PML-RARA.
25999785 2015 The promyelocytic leukemia protein is upregulated in conditions of obesity and liver steatosis.
25971581 2015 Promyelocytic leukemia protein enhances apoptosis of gastric cancer cells through Yes-associated protein.
25962098 2015 Cellular promyelocytic leukemia protein is an important dengue virus restriction factor.
25921172 2015 Promyelocytic Leukemia (PML) Gene Mutations may not Contribute to Gastric Adenocarcinoma Development.
25908860 2015 PML induces compaction, TRF2 depletion and DNA damage signaling at telomeres and promotes their alternative lengthening.
25892518 2015 PML suppresses IL-6-induced STAT3 activation by interfering with STAT3 and HDAC3 interaction.
25891951 2015 Nucleus accumbens associated 1 is recruited within the promyelocytic leukemia nuclear body through SUMO modification.
25812002 2015 Positive role of promyelocytic leukemia protein in type I interferon response and its regulation by human cytomegalovirus.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25772236 2016 PML isoforms IV and V contribute to adenovirus-mediated oncogenic transformation by functionally inhibiting the tumor-suppressor p53.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25733689 2015 Promyelocytic Leukemia Protein Isoform II Promotes Transcription Factor Recruitment To Activate Interferon Beta and Interferon-Responsive Gene Expression.
25497731 2015 Structural and functional characterization of the phosphorylation-dependent interaction between PML and SUMO1.
25457157 2015 Prognostic significance of promyelocytic leukemia expression in gastrointestinal stromal tumor; integrated proteomic and transcriptomic analysis.
25419843 2014 Microtubule-associated protein 1 light chain 3 interacts with and contributes to growth inhibiting effect of PML.
25355412 2014 The B-box 1 dimer of human promyelocytic leukemia protein.
25354534 2015 The key role of PML in IFN-? induced cellular senescence of human mesenchymal stromal cells.
25293974 2014 SCP phosphatases suppress renal cell carcinoma by stabilizing PML and inhibiting mTOR/HIF signaling.
25275592 2014 Transcriptional repression of CDKN2D by PML/RAR? contributes to the altered proliferation and differentiation block of acute promyelocytic leukemia cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25231954 2014 Expression of E6AP and PML predicts for prostate cancer progression and cancer-specific death.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25143485 2014 JAK2 and MPL protein levels determine TPO-induced megakaryocyte proliferation vs differentiation.
25032863 2014 Deacetylation of the tumor suppressor protein PML regulates hydrogen peroxide-induced cell death.
24943846 2014 Control of antioxidative response by the tumor suppressor protein PML through regulating Nrf2 activity.
24938310 2014 Novel common variants and susceptible haplotype for exfoliation glaucoma specific to Asian population.
24711541 2014 HIF factors cooperate with PML-RAR? to promote acute promyelocytic leukemia progression and relapse.
24615016 2014 The tumor suppressor PML specifically accumulates at RPA/Rad51-containing DNA damage repair foci but is nonessential for DNA damage-induced fibroblast senescence.
24586174 2014 Implication of PMLIV in both intrinsic and innate immunity.
24548562 2014 PML tumour suppression and beyond: therapeutic implications.
24487962 2014 USP11 regulates PML stability to control Notch-induced malignancy in brain tumours.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24288198 2014 Cytoplasmic PML: from molecular regulation to biological functions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255919 2014 PML4 facilitates erythroid differentiation by enhancing the transcriptional activity of GATA-1.
24101171 2013 PML overexpression inhibits proliferation and promotes the osteogenic differentiation of human mesenchymal stem cells.
24089549 2013 Two overlapping regions within the N-terminal half of the herpes simplex virus 1 E3 ubiquitin ligase ICP0 facilitate the degradation and dissociation of PML and dissociation of Sp100 from ND10.
24038216 2014 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBP? during granulocytic differentiation but repressed by PML-RAR? in APL.
24009715 2013 PML nuclear bodies and SATB1 are associated with HLA class I expression in EBV+ Hodgkin lymphoma.
23770850 2014 Coordinated regulation of the immunoproteasome subunits by PML/RAR? and PU.1 in acute promyelocytic leukemia.
23768491 2013 Proximity to PML nuclear bodies regulates HIV-1 latency in CD4+ T cells.
23620081 2013 Promyelocytic leukaemia protein links DNA damage response and repair to hepatitis B virus-related hepatocarcinogenesis.
23563092 2013 The PML isoform IV is a negative regulator of nuclear EGFR's transcriptional activity in lung cancer.
23542129 2013 Dual roles for lysine 490 of promyelocytic leukemia protein in the transactivation of glucocorticoid receptor-interacting protein 1.
23530056 2013 Arkadia, a novel SUMO-targeted ubiquitin ligase involved in PML degradation.
23492774 2013 Activation of protein kinase CK2 attenuates FOXO3a functioning in a PML-dependent manner: implications in human prostate cancer.
23448850 2013 The limited contribution of DNA methylation to PML-RAR? induced leukemia.
23440206 2013 PML mediates glioblastoma resistance to mammalian target of rapamycin (mTOR)-targeted therapies.
23431171 2013 MOZ increases p53 acetylation and premature senescence through its complex formation with PML.
23430110 2013 Selective inhibition of the NLRP3 inflammasome by targeting to promyelocytic leukemia protein in mouse and human.
23316480 2012 Post-translational modifications of PML: consequences and implications.
23221561 2013 Components of promyelocytic leukemia nuclear bodies (ND10) act cooperatively to repress herpesvirus infection.
23220564 2013 Downregulation of tumor suppressor gene PML in uterine cervical carcinogenesis: impact of human papillomavirus infection (HPV).
23219818 2013 PML tumor suppressor protein is required for HCV production.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23135708 2013 The adenoviral oncogene E1A-13S interacts with a specific isoform of the tumor suppressor PML to enhance viral transcription.
23092969 2012 Expression of promyelocytic leukemia protein and vascular endothelial growth factor in aqueous humor and vitreous fluid in patients with proliferative diabetic retinopathy.
23064710 2013 Sequence-specific electrochemical detection of double-strand PCR amplicons of PML/RAR? fusion gene in acute promyelocytic leukemia.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
23028697 2012 Requirement of PML SUMO interacting motif for RNF4- or arsenic trioxide-induced degradation of nuclear PML isoforms.
23007646 2012 PML promotes MHC class II gene expression by stabilizing the class II transactivator.
22982005 2012 Microarray, gene sequencing, and reverse transcriptase-polymerase chain reaction analyses of a cryptic PML-RARA translocation.
22947142 2012 Microarray analysis revealing common and distinct functions of promyelocytic leukemia protein (PML) and tumor necrosis factor alpha (TNF?) signaling in endothelial cells.
22945642 2013 The epigenetic regulator UHRF1 promotes ubiquitination-mediated degradation of the tumor-suppressor protein promyelocytic leukemia protein.
22935031 2012 The role of PML ubiquitination in human malignancies.
22918509 2013 Cytoplasmic localization of PML particles in laminopathies.
22915647 2012 A novel hierarchical prognostic model of AML solely based on molecular mutations.
22906876 2012 Association of promyelocytic leukemia protein with expression of IL-6 and resistance to treatment in multiple myeloma.
22886304 2012 A metabolic prosurvival role for PML in breast cancer.
22875967 2012 Herpes simplex virus 1 ubiquitin ligase ICP0 interacts with PML isoform I and induces its SUMO-independent degradation.
22869143 2013 BMK1 is involved in the regulation of p53 through disrupting the PML-MDM2 interaction.
22773875 2012 Contribution of the C-terminal regions of promyelocytic leukemia protein (PML) isoforms II and V to PML nuclear body formation.
22711534 2012 Interleukin 6 signaling regulates promyelocytic leukemia protein gene expression in human normal and cancer cells.
22685230 2012 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins.
22683601 2012 Nuclear translocation of DJ-1 during oxidative stress-induced neuronal cell death.
22641345 2012 Nucleostemin prevents telomere damage by promoting PML-IV recruitment to SUMOylated TRF1.
22589541 2012 Promyelocytic leukemia protein (PML) regulates endothelial cell network formation and migration in response to tumor necrosis factor ? (TNF?) and interferon ? (IFN?).
22573317 2012 Biophysical and functional analyses suggest that adenovirus E4-ORF3 protein requires higher-order multimerization to function against promyelocytic leukemia protein nuclear bodies.
22498738 2012 PU.1 is linking the glycolytic enzyme HK3 in neutrophil differentiation and survival of APL cells.
22406621 2012 The SUMO E3-ligase PIAS1 regulates the tumor suppressor PML and its oncogenic counterpart PML-RARA.
22296450 2012 A 15q24 microdeletion in transient myeloproliferative disease (TMD) and acute megakaryoblastic leukaemia (AMKL) implicates PML and SUMO3 in the leukaemogenesis of TMD/AMKL.
22274616 2012 PML regulates PER2 nuclear localization and circadian function.
22237204 2012 Role of the promyelocytic leukaemia protein in cell death regulation.
22155184 2012 ?-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells.
22117195 2012 MageA2 restrains cellular senescence by targeting the function of PMLIV/p53 axis at the PML-NBs.
22045732 2011 De novo assembly of a PML nuclear subcompartment occurs through multiple pathways and induces telomere elongation.
22033920 2011 Mitogen-activated protein kinase extracellular signal-regulated kinase 2 phosphorylates and promotes Pin1 protein-dependent promyelocytic leukemia protein turnover.
22022583 2011 Loss of the promyelocytic leukemia protein in gastric cancer: implications for IP-10 expression and tumor-infiltrating lymphocytes.
22002537 2012 Physical and functional interaction between PML and TBX2 in the establishment of cellular senescence.
21998700 2011 Functional connection between Rad51 and PML in homology-directed repair.
21994459 2011 Promyelocytic leukemia isoform IV confers resistance to encephalomyocarditis virus via the sequestration of 3D polymerase in nuclear bodies.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21934296 2011 The PML gene of the PML-RAR? V-form fusion transcript breaks within exon 6.
21840486 2011 A Cullin3-KLHL20 Ubiquitin ligase-dependent pathway targets PML to potentiate HIF-1 signaling and prostate cancer progression.
21832009 2011 General blockade of human cytomegalovirus immediate-early mRNA expression in the S/G2 phase by a nuclear, Daxx- and PML-independent mechanism.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21803845 2011 PMLRAR? binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo.
21752469 2012 MPL immunohistochemical expression as a novel marker for essential thrombocythemia and primary myelofibrosis differential diagnosis.
21678421 2012 PML expression in soft tissue sarcoma: prognostic and predictive value in alkylating agents/antracycline-based first line therapy.
21639834 2011 Promyelocytic leukemia protein interacts with werner syndrome helicase and regulates double-strand break repair in ?-irradiation-induced DNA damage responses.
21623375 2011 Genome-wide association identifies three new susceptibility loci for Paget's disease of bone.
21613260 2011 Missense mutations in PML-RARA are critical for the lack of responsiveness to arsenic trioxide treatment.
21529941 2011 A novel PML-ADAMTS17-RARA gene rearrangement in a patient with pregnancy-related acute promyelocytic leukemia.
21501958 2011 The nuclear bodies inside out: PML conquers the cytoplasm.
21489587 2011 Nuclear body formation and PML body remodeling by the human cytomegalovirus protein UL35.
21475307 2011 The role of PML in the control of apoptotic cell fate: a new key player at ER-mitochondria sites.
21430051 2011 The alphaherpesvirus serine/threonine kinase us3 disrupts promyelocytic leukemia protein nuclear bodies.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21364283 2011 PML-RARA can increase hematopoietic self-renewal without causing a myeloproliferative disease in mice.
21310922 2011 Regulation of S100A10 by the PML-RAR-? oncoprotein.
21305000 2011 The herpesvirus associated ubiquitin specific protease, USP7, is a negative regulator of PML proteins and PML nuclear bodies.
21304940 2011 Entrapment of viral capsids in nuclear PML cages is an intrinsic antiviral host defense against varicella-zoster virus.
21304169 2011 Functional reorganization of promyelocytic leukemia nuclear bodies during BK virus infection.
21269460 2011 Initial characterization of the human central proteome.
21245861 2011 Genome-wide functions of PML-RAR? in acute promyelocytic leukaemia.
21240990 2011 PML protein as a prognostic molecular marker for patients with esophageal squamous cell carcinomas receiving primary surgery.
21217775 2011 PAX5-PML acts as a dual dominant-negative form of both PAX5 and PML.
21205865 2011 Regulation of E2Fs and senescence by PML nuclear bodies.
21198351 2011 Role of promyelocytic leukemia protein in host antiviral defense.
21192925 2011 Role of the SUMO-interacting motif in HIPK2 targeting to the PML nuclear bodies and regulation of p53.
21187718 2011 Autophagy regulates myeloid cell differentiation by p62/SQSTM1-mediated degradation of PML-RAR? oncoprotein.
21172801 2011 PML isoforms I and II participate in PML-dependent restriction of HSV-1 replication.
21161613 2011 The role of PML in the nervous system.
21148299 2011 The SUMO protease SENP6 is a direct regulator of PML nuclear bodies.
21115099 2011 PML positively regulates interferon gamma signaling.
21092142 2010 Subcellular distribution of nuclear import-defective isoforms of the promyelocytic leukemia protein.
21057547 2011 AXIN is an essential co-activator for the promyelocytic leukemia protein in p53 activation.
21042751 2010 Telomerase suppression initiates PML-dependent p53 activation to inhibit bladder cancer cell growth.
21037079 2010 Pilocytic astrocytomas have telomere-associated promyelocytic leukemia bodies without alternatively lengthened telomeres.
20972455 2011 The reduced and altered activities of PAX5 are linked to the protein-protein interaction motif (coiled-coil domain) of the PAX5-PML fusion protein in t(9;15)-associated acute lymphocytic leukemia.
20943951 2010 Arsenic-induced SUMO-dependent recruitment of RNF4 into PML nuclear bodies.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20832753 2010 Pharmacological inhibition of BMK1 suppresses tumor growth through promyelocytic leukemia protein.
20826694 2010 SUMOylation promotes PML degradation during encephalomyocarditis virus infection.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20719947 2010 Epstein-Barr virus nuclear antigen 1 Hijacks the host kinase CK2 to disrupt PML nuclear bodies.
20702643 2010 Resistance to rabies virus infection conferred by the PMLIV isoform.
20699642 2010 Regulation of the PML tumor suppressor in drug-induced senescence of human normal and cancer cells by JAK/STAT-mediated signaling.
20639899 2010 SUMO modification of E1B-55K oncoprotein regulates isoform-specific binding to the tumour suppressor protein PML.
20625391 2010 Functional polymorphism of the CK2alpha intronless gene plays oncogenic roles in lung cancer.
20578240 2010 PML down-regulation in soft tissue sarcomas.
20574048 2010 Autophagy contributes to therapy-induced degradation of the PML/RARA oncoprotein.
20544846 2010 Analysis of t(15;17) chromosomal breakpoint sequences in therapy-related versus de novo acute promyelocytic leukemia: association of DNA breaks with specific DNA motifs at PML and RARA loci.
20501696 2010 Two-step colocalization of MORC3 with PML nuclear bodies.
20389280 2010 The Cullin 3 substrate adaptor KLHL20 mediates DAPK ubiquitination to control interferon responses.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378816 2010 Arsenic trioxide controls the fate of the PML-RARalpha oncoprotein by directly binding PML.
20228380 2010 Dysregulation of promyelocytic leukemia (PML) protein expression in preeclamptic placentae.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20181954 2010 SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress.
20159610 2010 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia.
20159609 2010 PML-RARalpha/RXR Alters the Epigenetic Landscape in Acute Promyelocytic Leukemia.
20155840 2010 Atypical mRNA fusions in PML-RARA positive, RARA-PML negative acute promyelocytic leukemia.
20133893 2010 Long FLT3 internal tandem duplications and reduced PML-RAR? expression at diagnosis characterize a high-risk subgroup of acute promyelocytic leukemia patients.
20133705 2010 PML/RARalpha fusion protein transactivates the tissue factor promoter through a GAGC-containing element without direct DNA association.
20130140 2010 Three-dimensional organization of promyelocytic leukemia nuclear bodies.
20123968 2010 Gamma interferon-dependent transcriptional memory via relocalization of a gene locus to PML nuclear bodies.
20100838 2010 Promyelocytic leukemia protein controls cell migration in response to hydrogen peroxide and insulin-like growth factor-1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19865110 2010 PML-RARalpha ligand-binding domain deletion mutations associated with reduced disease control and outcome after first relapse of APL.
19863682 2010 Expression patterns of specific promyelocytic/retinoic acid receptor-alpha transcripts in patients with acute promyelocytic leukemia.
19861416 2010 Novel nuclear nesprin-2 variants tether active extracellular signal-regulated MAPK1 and MAPK2 at promyelocytic leukemia protein nuclear bodies and act to regulate smooth muscle cell proliferation.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19808906 2009 Promyelocytic leukemia nuclear bodies link the DNA damage repair pathway with hepatitis B virus replication: implications for hepatitis B virus exacerbation during chemotherapy and radiotherapy.
19728758 2009 Germline variants of the promyelocytic leukemia tumor suppressor gene in patients with familial cancer.
19703418 2009 Differential suppressive effect of promyelocytic leukemia protein on the replication of different subtypes/strains of influenza A virus.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19597475 2009 PML involvement in the p73-mediated E1A-induced suppression of EGFR and induction of apoptosis in head and neck cancers.
19567472 2009 PML-IV functions as a negative regulator of telomerase by interacting with TERT.
19553342 2009 Kaposi's sarcoma-associated herpesvirus protein LANA2 disrupts PML oncogenic domains and inhibits PML-mediated transcriptional repression of the survivin gene.
19487292 2009 Promyelocytic leukemia protein is required for gain of function by mutant p53.
19380586 2009 Role of SUMO in RNF4-mediated promyelocytic leukemia protein (PML) degradation: sumoylation of PML and phospho-switch control of its SUMO binding domain dissected in living cells.
19339552 2009 Cell-cycle regulation and dynamics of cytoplasmic compartments containing the promyelocytic leukemia protein and nucleoporins.
19322209 2009 PML-RARalpha initiates leukemia by conferring properties of self-renewal to committed promyelocytic progenitors.
19224461 2009 Identification of PML/RARalpha fusion gene transcripts that showed no t(15;17) with conventional karyotyping and fluorescent in situ hybridization.
19150978 2009 PML3 Orchestrates the Nuclear Dynamics and Function of TIP60.
19111660 2008 PML, YAP, and p73 are components of a proapoptotic autoregulatory feedback loop.
19100514 2009 Acute promyelocytic leukemia with insertion of PML exon 7a and partial deletion of exon 3 of RARA: a novel variant transcript related to aggressive course and not detected with real-time polymerase chain reaction analysis.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19029980 2008 Eradication of acute promyelocytic leukemia-initiating cells through PML-RARA degradation.
19023333 2009 The tumor suppressor protein PML controls apoptosis induced by the HIV-1 envelope.
19015637 2009 PML tumor suppressor is regulated by HIPK2-mediated phosphorylation in response to DNA damage.
18945770 2009 The two functions of herpes simplex virus 1 ICP0, inhibition of silencing by the CoREST/REST/HDAC complex and degradation of PML, are executed in tandem.
18856066 [Increase of BIRC5 gene expression in non-small cell lung cancer and esophageal squamous cell carcinoma does not correlate with expression of genes SMAC/DIABLO and PML encoding its inhibitors].
18833293 2008 Epstein-Barr nuclear antigen 1 contributes to nasopharyngeal carcinoma through disruption of PML nuclear bodies.
18812519 2009 Promyelocytic leukemia protein induces apoptosis due to caspase-8 activation via the repression of NFkappaB activation in glioblastoma.
18809579 2008 PML activates transcription by protecting HIPK2 and p300 from SCFFbx3-mediated degradation.
18755984 2008 Activating mutations in human acute megakaryoblastic leukemia.
18716620 2008 The deubiquitinylation and localization of PTEN are regulated by a HAUSP-PML network.
18689862 2009 Promyelocytic leukemia (PML) gene expression is a prognostic factor in ampullary cancer patients.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18664490 2008 Dynamics of component exchange at PML nuclear bodies.
18636556 2008 PML/RARalpha fusion protein mediates the unique sensitivity to arsenic cytotoxicity in acute promyelocytic leukemia cells: Mechanisms involve the impairment of cAMP signaling and the aberrant regulation of NADPH oxidase.
18625722 2008 Histone deacetylase 7 promotes PML sumoylation and is essential for PML nuclear body formation.
18621739 2008 Acetylation of PML is involved in histone deacetylase inhibitor-mediated apoptosis.
18566754 2008 CK2 mediates phosphorylation and ubiquitin-mediated degradation of the PML tumor suppressor.
18511908 2008 Identification of PCTA, a TGIF antagonist that promotes PML function in TGF-beta signalling.
18509536 2008 A role for cytoplasmic PML in cellular resistance to viral infection.
18480450 2008 Cellular proteins PML and Daxx mediate an innate antiviral defense antagonized by the adenovirus E4 ORF3 protein.
18463162 2008 Signal-dependent regulation of transcription by histone deacetylase 7 involves recruitment to promyelocytic leukemia protein nuclear bodies.
18408734 2008 RNF4 is a poly-SUMO-specific E3 ubiquitin ligase required for arsenic-induced PML degradation.
18298799 2008 Modulation of M2-type pyruvate kinase activity by the cytoplasmic PML tumor suppressor protein.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18246126 2008 PML enhances the regulation of p53 by CK1 in response to DNA damage.
18246125 2008 Selective activation of NFAT by promyelocytic leukemia protein.
18160400 2008 Hes6 controls cell proliferation via interaction with cAMP-response element-binding protein-binding protein in the promyelocytic leukemia nuclear body.
18158568 2007 Significance of PML and p53 protein as molecular prognostic markers of gallbladder carcinomas.
18056407 2007 Lack of TRF2 in ALT cells causes PML-dependent p53 activation and loss of telomeric DNA.
18039859 2008 Degradation of the tumor suppressor PML by Pin1 contributes to the cancer phenotype of breast cancer MDA-MB-231 cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18024792 2008 Chromatin modifications induced by PML-RARalpha repress critical targets in leukemogenesis as analyzed by ChIP-Chip.
17996922 Expression and localization of Werner syndrome protein is modulated by SIRT1 and PML.
17991421 2008 Coiled-coil domain of PML is essential for the aberrant dynamics of PML-RARalpha, resulting in sequestration and decreased mobility of SMRT.
17960172 2008 The presence of a single PML-RARA isoform lacking exon 5 in FISH-negative APL samples.
17943164 2008 The genetic characterization of acute promyelocytic leukemia with cryptic t(15;17) including a new recurrent additional cytogenetic abnormality i(17)(q10).
17942542 2008 Nuclear domain 10 components promyelocytic leukemia protein and hDaxx independently contribute to an intrinsic antiviral defense against human cytomegalovirus infection.
17878236 2007 A nucleolar targeting signal in PML-I addresses PML to nucleolar caps in stressed or senescent cells.
17822314 2007 PML protein expression in hereditary and sporadic breast cancer.
17767548 2007 Concordant expression of proto-oncogene promyelocytic leukemia and major histocompatibility antigen HLA class I in human hepatocellular carcinoma.
17562868 2007 PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.
17543368 2007 Induction of promyelocytic leukemia (PML) oncogenic domains (PODs) by papillomavirus.
17475621 2007 Aberrant association of promyelocytic leukemia protein-retinoic acid receptor-alpha with coactivators contributes to its ability to regulate gene expression.
17441430 2007 [Expression of PML in carcinogenesis of laryngocarcinoma and nasopharyngeal carcinoma].
17428679 2007 PML protein association with specific nucleolar structures differs in normal, tumor and senescent human cells.
17419608 2007 Nuclear phospholipase C gamma: punctate distribution and association with the promyelocytic leukemia protein.
17360386 2007 Modification of nuclear PML protein by SUMO-1 regulates Fas-induced apoptosis in rheumatoid arthritis synovial fibroblasts.
17332504 2007 Dynamic regulation of p53 subnuclear localization and senescence by MORC3.
17173041 2007 Functional interaction between PML and SATB1 regulates chromatin-loop architecture and transcription of the MHC class I locus.
17172828 2006 A cytoplasmic PML mutant inhibits p53 function.
17146439 2007 PML4 induces differentiation by Myc destabilization.
17081985 2006 The mechanisms of PML-nuclear body formation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17062732 2007 Histone deacetylase inhibitors suppress IFNalpha-induced up-regulation of promyelocytic leukemia protein.
17036045 2006 An extended consensus motif enhances the specificity of substrate modification by SUMO.
17030982 2006 Promyelocytic leukemia nuclear bodies behave as DNA damage sensors whose response to DNA double-strand breaks is regulated by NBS1 and the kinases ATM, Chk2, and ATR.
17027752 2006 ZNF198, a zinc finger protein rearranged in myeloproliferative disease, localizes to the PML nuclear bodies and interacts with SUMO-1 and PML.
16935935 2006 Retinoic acid induces leukemia cell G1 arrest and transition into differentiation by inhibiting cyclin-dependent kinase-activating kinase binding and phosphorylation of PML/RARalpha.
16924230 2007 Apoptin is modified by SUMO conjugation and targeted to promyelocytic leukemia protein nuclear bodies.
16916642 2006 Nuclear retention of the tumor suppressor cPML by the homeodomain protein TGIF restricts TGF-beta signaling.
16915281 2006 PML inhibits HIF-1alpha translation and neoangiogenesis through repression of mTOR.
16912307 2006 Cross talk between PML and p53 during poliovirus infection: implications for antiviral defense.
16909106 2007 PRIMA-1(MET) induces nucleolar accumulation of mutant p53 and PML nuclear body-associated proteins.
16873257 2006 Evidence for a role of the cellular ND10 protein PML in mediating intrinsic immunity against human cytomegalovirus infections.
16873256 2006 PML contributes to a cellular mechanism of repression of herpes simplex virus type 1 infection that is inactivated by ICP0.
16873060 2006 A CK2-dependent mechanism for degradation of the PML tumor suppressor.
16818720 2006 PML clastosomes prevent nuclear accumulation of mutant ataxin-7 and other polyglutamine proteins.
16797070 2007 Identification of PML-RARA rearrangement by RT-PCR and sequencing in an acute promyelocytic leukemia without t(15;17) on G-banding and FISH.
16778193 2006 Characterization of endogenous human promyelocytic leukemia isoforms.
16630218 2006 PML-RARalpha fusion gene transcripts and biological features in acute promyelocytic leukemia patients.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16540467 2006 Cytoplasmic function of mutant promyelocytic leukemia (PML) and PML-retinoic acid receptor-alpha.
16501610 2006 The promyelocytic leukemia protein stimulates SUMO conjugation in yeast.
16501113 2006 Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption.
16449642 2006 Recruitment of the histone methyltransferase SUV39H1 and its role in the oncogenic properties of the leukemia-associated PML-retinoic acid receptor fusion protein.
16432238 2006 The methyl-CpG binding protein MBD1 is required for PML-RARalpha function.
16322229 2005 Hepatitis C virus core protein inhibits tumor suppressor protein promyelocytic leukemia function in human hepatoma cells.
16307818 2006 Functional interactions between the Epstein-Barr virus BZLF1 protein and the promyelocytic leukemia protein.
16154611 2005 Serum-dependent expression of promyelocytic leukemia protein suppresses propagation of influenza virus.
16113082 2005 Reduced PU.1 expression causes myeloid progenitor expansion and increased leukemia penetrance in mice expressing PML-RARalpha.
16007146 2005 The promyelocytic leukaemia protein tumour suppressor functions as a transcriptional regulator of p63.
15968309 2005 [Role of molecular screening for common fusion genes in the diagnosis and classification of leukemia].
15922731 2005 Isoforms of the promyelocytic leukemia protein differ in their effects on ND10 organization.
15855159 2005 Immediate early gene X1 (IEX-1) is organized in subnuclear structures and partially co-localizes with promyelocytic leukemia protein in HeLa cells.
15809060 2005 Requirement of the coiled-coil domain of PML-RARalpha oncoprotein for localization, sumoylation, and inhibition of monocyte differentiation.
15749021 2005 A role for PML3 in centrosome duplication and genome stability.
15746941 2005 Triterpenoid CDDO-Im downregulates PML/RARalpha expression in acute promyelocytic leukemia cells.
15735755 2005 PML interacts with Myc, and Myc target gene expression is altered in PML-null fibroblasts.
15626733 2005 The promyelocytic leukemia protein PML regulates c-Jun function in response to DNA damage.
15601827 2005 Neutrophil elastase is important for PML-retinoic acid receptor alpha activities in early myeloid cells.
15589835 2004 Ini1/hSNF5 is dispensable for retrovirus-induced cytoplasmic accumulation of PML and does not interfere with integration.
15569683 2005 Noncovalent SUMO-1 binding activity of thymine DNA glycosylase (TDG) is required for its SUMO-1 modification and colocalization with the promyelocytic leukemia protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467728 2004 PML bodies control the nuclear dynamics and function of the CHFR mitotic checkpoint protein.
15459016 2005 PML mediates IFN-alpha-induced apoptosis in myeloma by regulating TRAIL induction.
15359634 2004 More on geographic hematology: the breakpoint cluster regions of the PML/RARalpha fusion gene in Mexican Mestizo patients with promyelocytic leukemia are different from those in Caucasians.
15356634 2004 Cytoplasmic PML function in TGF-beta signalling.
15331439 2005 Physical and functional link of the leukemia-associated factors AML1 and PML.
15273249 2004 Promyelocytic leukemia is a direct inhibitor of SAPK2/p38 mitogen-activated protein kinase.
15195100 2004 PML regulates p53 stability by sequestering Mdm2 to the nucleolus.
15194430 2004 c-Myb associates with PML in nuclear bodies in hematopoietic cells.
15184504 2004 Ubiquitin-dependent degradation of p73 is inhibited by PML.
15163746 2004 Ability of the human cytomegalovirus IE1 protein to modulate sumoylation of PML correlates with its functional activities in transcriptional regulation and infectivity in cultured fibroblast cells.
15136035 2004 The Ankrd2 protein, a link between the sarcomere and the nucleus in skeletal muscle.
15096541 2004 PML-RARA-RXR oligomers mediate retinoid and rexinoid/cAMP cross-talk in acute promyelocytic leukemia cell differentiation.
15060166 2004 Repression of PML nuclear body-associated transcription by oxidative stress-activated Bach2.
14992722 2004 PML is a direct p53 target that modulates p53 effector functions.
14976184 2004 Myeloid Elf-1-like factor, an ETS transcription factor, up-regulates lysozyme transcription in epithelial cells through interaction with promyelocytic leukemia protein.
14970276 2004 Loss of the tumor suppressor PML in human cancers of multiple histologic origins.
14970191 2004 Promyelocytic leukemia nuclear bodies associate with transcriptionally active genomic regions.
14715247 2004 Androgen suppresses PML protein expression in prostate cancer CWR22R cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14663483 2003 Role of PML and the PML-nuclear body in the control of programmed cell death.
14645235 2004 The coiled-coil domain is the structural determinant for mammalian homologues of Drosophila Sina-mediated degradation of promyelocytic leukemia protein and other tripartite motif proteins by the proteasome.
14630830 2004 Mutations of the PML tumor suppressor gene in acute promyelocytic leukemia.
14597990 2003 PML/RARalpha plays a role for basal activity and retinoid-induced repression of the tissue factor promoter in acute promyelocytic leukemia cells.
14597622 2004 Promyelocytic leukemia protein 4 induces apoptosis by inhibition of survivin expression.
14534537 2003 Leukemia-associated translocation products able to activate RAS modify PML and render cells sensitive to arsenic-induced apoptosis.
14528266 2003 Adenovirus protein IX sequesters host-cell promyelocytic leukaemia protein and contributes to efficient viral proliferation.
14526201 2003 High frequency of alternative splicing of human genes participating in the HIV-1 life cycle: a model using TSG101, betaTrCP, PPIA, INI1, NAF1, and PML.
14517282 2003 Daxx silencing sensitizes cells to multiple apoptotic pathways.
14507915 2003 MDM2 and promyelocytic leukemia antagonize each other through their direct interaction with p53.
12950020 2003 Promyelocytic leukaemia (PML) protein expression in human placenta and choriocarcinoma.
12935927 2003 New highly sensitive fluorescence in situ hybridization method to detect PML/RARA fusion in acute promyelocytic leukemia.
12917339 2003 ZIP kinase triggers apoptosis from nuclear PML oncogenic domains.
12915590 2003 Cellular stress and DNA damage invoke temporally distinct Mdm2, p53 and PML complexes and damage-specific nuclear relocalization.
12907596 2003 PML is required for homeodomain-interacting protein kinase 2 (HIPK2)-mediated p53 phosphorylation and cell cycle arrest but is dispensable for the formation of HIPK domains.
12837286 2003 Forced expression of RNF36 induces cell apoptosis.
12810724 2003 The promyelocytic leukemia protein protects p53 from Mdm2-mediated inhibition and degradation.
12773567 2003 PML colocalizes with and stabilizes the DNA damage response protein TopBP1.
12759344 2003 Physical and functional interactions between PML and MDM2.
12727882 2003 Recruitment of human cyclin T1 to nuclear bodies through direct interaction with the PML protein.
12717420 2003 THAP1 is a nuclear proapoptotic factor that links prostate-apoptosis-response-4 (Par-4) to PML nuclear bodies.
12691149 2003 Cytogenetics, FISH and RT-PCR analysis of acute promyelocytic leukemia: structure of the fusion point in a case lacking classic t(15;17) translocation.
12647219 2003 Expression of promyelocytic leukemia protein increases during the differentiation of human neuroblastoma cells.
12622724 2003 PML-nuclear bodies are involved in cellular serum response.
12610143 2003 Recruitment of herpes simplex virus type 1 transcriptional regulatory protein ICP4 into foci juxtaposed to ND10 in live, infected cells.
12595526 2003 Promyelocytic leukemia protein (PML) functions as a glucocorticoid receptor co-activator by sequestering Daxx to the PML oncogenic domains (PODs) to enhance its transactivation potential.
12540841 2003 Promyelocytic leukemia protein sensitizes tumor necrosis factor alpha-induced apoptosis by inhibiting the NF-kappaB survival pathway.
12529400 2003 Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity.
12506025 2003 The PML gene is not involved in the regulation of MHC class I expression in human cell lines.
12506013 2003 Opposing effects of PML and PML/RAR alpha on STAT3 activity.
12505266 2002 Cryptic translocation of PML/RARA on 17q. A rare event in acute promyelocytic leukemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439746 2002 Rabies virus P and small P products interact directly with PML and reorganize PML nuclear bodies.
12438698 2002 Control of biochemical reactions through supramolecular RING domain self-assembly.
12419228 2002 SUMO-1 protease-1 regulates gene transcription through PML.
12402044 2002 PML-dependent apoptosis after DNA damage is regulated by the checkpoint kinase hCds1/Chk2.
12384561 2002 PML is a target gene of beta-catenin and plakoglobin, and coactivates beta-catenin-mediated transcription.
12354770 2002 The aryl hydrocarbon receptor nuclear transporter is modulated by the SUMO-1 conjugation system.
12234245 An assessment of progress in the use of alternatives in toxicity testing since the publication of the report of the second FRAME Toxicity Committee (1991).
12186918 2002 Overexpression of promyelocytic leukemia protein precludes the dispersal of ND10 structures and has no effect on accumulation of infectious herpes simplex virus 1 or its proteins.
12167712 2002 Gamma interferon and cadmium treatments modulate eukaryotic initiation factor 4E-dependent mRNA transport of cyclin D1 in a PML-dependent manner.
12142048 2002 Differential expression of the suppressor PML and Ki-67 identifies three subtypes of human nasopharyngeal carcinoma.
12093737 2002 Deconstructing PML-induced premature senescence.
12080044 2002 The promyelocytic leukemia protein represses A20-mediated transcription.
12060771 2002 PML/RARalpha and FLT3-ITD induce an APL-like disease in a mouse model.
12032831 2002 Promyelocytic leukemia protein PML inhibits Nur77-mediated transcription through specific functional interactions.
12032336 2002 Variant-type PML-RAR(alpha) fusion transcript in acute promyelocytic leukemia: use of a cryptic coding sequence from intron 2 of the RAR(alpha) gene and identification of a new clinical subtype resistant to retinoic acid therapy.
12006491 2002 Human SIR2 deacetylates p53 and antagonizes PML/p53-induced cellular senescence.
11948183 2002 Essential role of the 58-kDa microspherule protein in the modulation of Daxx-dependent transcriptional repression as revealed by nucleolar sequestration.
11940591 2002 The HMG-I/Y-related protein p8 binds to p300 and Pax2 trans-activation domain-interacting protein to regulate the trans-activation activity of the Pax2A and Pax2B transcription factors on the glucagon gene promoter.
11891284 2002 UBE1L is a retinoid target that triggers PML/RARalpha degradation and apoptosis in acute promyelocytic leukemia.
11832207 2002 The role of PML in tumor suppression.
11704853 2001 PML interaction with p53 and its role in apoptosis and replicative senescence.
11704850 2001 PML protein isoforms and the RBCC/TRIM motif.
11585900 2001 Arsenic trioxide is a potent inhibitor of the interaction of SMRT corepressor with Its transcription factor partners, including the PML-retinoic acid receptor alpha oncoprotein found in human acute promyelocytic leukemia.
11500381 2001 PML RING suppresses oncogenic transformation by reducing the affinity of eIF4E for mRNA.
11432836 2001 PML mediates the interferon-induced antiviral state against a complex retrovirus via its association with the viral transactivator.
11430827 2001 Cytoplasmic recruitment of INI1 and PML on incoming HIV preintegration complexes: interference with early steps of viral replication.
11430826 2001 Role of PML and PML-RARalpha in Mad-mediated transcriptional repression.
11331580 2001 The tripartite motif family identifies cell compartments.
11259576 2001 The growth suppressor PML represses transcription by functionally and physically interacting with histone deacetylases.
11175338 2000 Colocalization and heteromerization between the two human oncogene POZ/zinc finger proteins, LAZ3 (BCL6) and PLZF.
11158586 2001 Proteins associated with the promyelocytic leukemia gene product (PML)-containing nuclear body move to the nucleolus upon inhibition of proteasome-dependent protein degradation.
11080164 2000 Regulation of p53 activity in nuclear bodies by a specific PML isoform.
11025664 2000 The function of PML in p53-dependent apoptosis.
10938104 2000 Potentiation of GATA-2 activity through interactions with the promyelocytic leukemia protein (PML) and the t(15;17)-generated PML-retinoic acid receptor alpha oncoprotein.
10910364 2000 PML regulates p53 acetylation and premature senescence induced by oncogenic Ras.
10806494 2000 The transcriptional role of PML and the nuclear body.
10779416 2000 Role of SUMO-1-modified PML in nuclear body formation.
10684855 2000 Promyelocytic leukemia protein (PML) and Daxx participate in a novel nuclear pathway for apoptosis.
10669754 2000 Sequestration and inhibition of Daxx-mediated transcriptional repression by PML.
10610177 1999 A RA-dependent, tumour-growth suppressive transcription complex is the target of the PML-RARalpha and T18 oncoproteins.
10597310 1999 The promyelocytic leukemia protein PML interacts with the proline-rich homeodomain protein PRH: a RING may link hematopoiesis and growth control.
10525530 1999 PML is critical for ND10 formation and recruits the PML-interacting protein daxx to this nuclear structure when modified by SUMO-1.
10077561 1999 Modulation of CREB binding protein function by the promyelocytic (PML) oncoprotein suggests a role for nuclear bodies in hormone signaling.
9885291 1999 SUMO-1 modification of the acute promyelocytic leukaemia protein PML: implications for nuclear localisation.
9819401 1998 The promyelocytic leukemia protein interacts with Sp1 and inhibits its transactivation of the epidermal growth factor receptor promoter.
9756909 1998 Identification of three major sentrinization sites in PML.
9671405 1998 Modulation of Fos-mediated AP-1 transcription by the promyelocytic leukemia protein.
9583681 1998 Recombinant PML adenovirus suppresses growth and tumorigenicity of human breast cancer cells by inducing G1 cell cycle arrest and apoptosis.
9570750 1998 Ret finger protein is a normal component of PML nuclear bodies and interacts directly with PML.
9452416 1998 Covalent modification of PML by the sentrin family of ubiquitin-like proteins.
9448006 1998 The promyelocytic leukemia gene product (PML) forms stable complexes with the retinoblastoma protein.
9420283 1998 An arenavirus RING (zinc-binding) protein binds the oncoprotein promyelocyte leukemia protein (PML) and relocates PML nuclear bodies to the cytoplasm.
9412458 1997 Evidence for covalent modification of the nuclear dot-associated proteins PML and Sp100 by PIC1/SUMO-1.
9395203 1997 Stable overexpression of PML alters regulation of cell cycle progression in HeLa cells.
9294197 1997 Leukemia-associated retinoic acid receptor alpha fusion partners, PML and PLZF, heterodimerize and colocalize to nuclear bodies.
9230084 1997 Cellular localization, expression, and structure of the nuclear dot protein 52.
8806687 1996 PIC 1, a novel ubiquitin-like protein which interacts with the PML component of a multiprotein complex that is disrupted in acute promyelocytic leukaemia.
8643677 1996 In vivo and in vitro characterization of the B1 and B2 zinc-binding domains from the acute promyelocytic leukemia protooncoprotein PML.
8394219 1993 The acute promyelocytic leukemia-specific PML-RAR alpha fusion protein inhibits differentiation and promotes survival of myeloid precursor cells.
8380300 1993 Localization of the chromosome 15 breakpoints and expression of multiple PML-RAR alpha transcripts in acute promyelocytic leukemia: a study of 28 Chinese patients.
8274203 1993 Molecular study on the chromosome 15 breakpoints in the translocation t(15; 17) in acute promyelocytic leukemia (APL).
7935403 1994 PML, a growth suppressor disrupted in acute promyelocytic leukemia.
7780148 1995 The PML gene encodes a phosphoprotein associated with the nuclear matrix.
7729428 1995 The solution structure of the RING finger domain from the acute promyelocytic leukaemia proto-oncoprotein PML.
1720570 1991 Characterization of a zinc finger gene disrupted by the t(15;17) in acute promyelocytic leukemia.
1652369 1991 The PML-RAR alpha fusion mRNA generated by the t(15;17) translocation in acute promyelocytic leukemia encodes a functionally altered RAR.
1652368 1991 Chromosomal translocation t(15;17) in human acute promyelocytic leukemia fuses RAR alpha with a novel putative transcription factor, PML.
1594241 1992 Alternative splicing of PML transcripts predicts coexpression of several carboxy-terminally different protein isoforms.
1312695 1992 Molecular rearrangements of the MYL gene in acute promyelocytic leukemia (APL, M3) define a breakpoint cluster region as well as some molecular variants.
1311253 1992 Structure, localization and transcriptional properties of two classes of retinoic acid receptor alpha fusion proteins in acute promyelocytic leukemia (APL): structural similarities with a new family of oncoproteins.