Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.93
PubTator Score 15.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.200 2.8e-03
medulloblastoma, large-cell 1.100 8.5e-06
group 3 medulloblastoma 1.300 5.5e-04
ovarian cancer 1.100 3.9e-05

Gene RIF (3)

PMID Text
22682992 Bladder carcinoma with unmethylated PMF1 was more likely to recur after BCG treatment.
19088041 The association of PMF1 methylation with tumor progression and its diagnostic ability using urinary specimens support including PMF1 assessment for the clinical management of bladder cancer patients.
12020345 Polyamine-modulated factor 1 binds to CSN7.

AA Sequence

MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQP      1 - 70
AMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPY     71 - 140
FLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE         141 - 205
//

Text Mined References (18)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24656865 2014 Meta-analysis of genome-wide association studies identifies 1q22 as a susceptibility locus for intracerebral hemorrhage.
22682992 2013 Polyamine-modulated factor-1 methylation predicts Bacillus Calmette-Guérin response in patients with high-grade non-muscle-invasive bladder carcinoma.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
19088041 2008 Identification of PMF1 methylation in association with bladder cancer progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16585270 2006 The human Mis12 complex is required for kinetochore assembly and proper chromosome segregation.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371340 2004 A conserved protein network controls assembly of the outer kinetochore and its ability to sustain tension.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12020345 2002 Polyamine-modulated factor 1 binds to the human homologue of the 7a subunit of the Arabidopsis COP9 signalosome: implications in gene expression.
11256947 2001 Characterization of the interaction between the transcription factors human polyamine modulated factor (PMF-1) and NF-E2-related factor 2 (Nrf-2) in the transcriptional regulation of the spermidine/spermine N1-acetyltransferase (SSAT) gene.
10419538 1999 Cloning and characterization of human polyamine-modulated factor-1, a transcriptional cofactor that regulates the transcription of the spermidine/spermine N(1)-acetyltransferase gene.