Property Summary

NCBI Gene PubMed Count 100
PubMed Score 440.94
PubTator Score 592.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (35)

Disease log2 FC p
chronic lymphocytic leukemia 1.930 7.0e-04
gastric cancer -1.200 4.2e-03
hepatocellular carcinoma -1.600 6.5e-05
pancreatic cancer -1.800 1.4e-03
Waldenstrons macroglobulinemia 3.155 5.1e-03
urothelial carcinoma -1.600 2.1e-02
malignant mesothelioma 1.300 2.0e-04
psoriasis -1.500 2.3e-05
osteosarcoma 3.249 4.3e-05
posterior fossa group A ependymoma 1.400 4.3e-05
glioblastoma 3.000 3.4e-04
sonic hedgehog group medulloblastoma 2.300 2.3e-05
atypical teratoid / rhabdoid tumor 1.300 1.1e-02
medulloblastoma, large-cell 2.100 1.4e-03
primitive neuroectodermal tumor 2.800 4.3e-05
adrenocortical carcinoma 2.117 5.9e-03
pancreatic ductal adenocarcinoma liver m... 1.286 1.5e-02
non-small cell lung cancer 1.463 1.3e-10
intraductal papillary-mucinous carcinoma... 2.000 6.1e-03
intraductal papillary-mucinous neoplasm ... 2.300 3.3e-03
lung cancer 2.200 5.0e-05
pediatric high grade glioma 2.500 8.3e-05
non primary Sjogren syndrome sicca -1.400 1.1e-02
pancreatic carcinoma -1.800 1.4e-03
invasive ductal carcinoma 1.409 2.6e-02
nasopharyngeal carcinoma 2.000 3.9e-03
lung adenocarcinoma 1.036 4.3e-02
spina bifida -2.447 4.4e-02
pterygium -1.600 3.9e-02
Bipolar Disorder 1.706 4.7e-02
ductal carcinoma in situ 1.100 1.5e-02
acute myeloid leukemia 1.900 3.9e-02
ulcerative colitis 2.400 5.9e-09
ovarian cancer 1.300 7.5e-03
pituitary cancer -4.400 9.1e-07

Protein-protein Interaction (1)

Gene RIF (83)

PMID Text
26497683 Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26422397 SATB1 as a Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes
25975837 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25922916 BCL2 and BCLX phosphorylation represents a priming event in mitotic cell death that is triggered by NOXA-dependent MCL1 degradation. The MCL1 decay allows in turn BIM-dependent cell death.
25829494 CDK5 activity provides resistance to heat-induced apoptosis through the expression of miR-23a and subsequent suppression of NOXA synthesis
25714012 Noxa demethylation has a role in Bortezomib resistance in mantle cell lymphoma
25429623 Cells overexpressing HSP70 had higher levels of miR-23a, maintained these levels after heat shock and accumulated lower levels of NOXA mRNA and protein.
25404713 Overexpression of nonphosphorylatable Noxa resulted in enhanced mitochondria-mediated apoptosis in the infected epithelium.
25365078 Results reveal that oncogenic activation of MEK/ERK drives Noxa expression to promote autophagy, and suggest that Noxa has an indirect anti-apoptosis role in melanoma cells under nutrient starvation conditions.
25210795 Mcl-1/Noxa axis is important to overcome resistance to mitochondrial apoptosis in squamous cell carcinoma.
24991768 Noxa upregulation reduces the availability of Usp9x to Mcl-1, thereby promoting its ubiquitination and degradation, leading to the apoptosis of neoplastic cells.
24901046 Overexpression of ApoL2 did not induce cell death on its own. ApoL2 did not sensitize or protect cells from overexpression of the BH3-only proteins Bmf or Noxa.
24811167 these results suggest that the C-terminal tail of Noxa regulates the stability of both Noxa and Mcl-1.
24525728 Noxa recruits MCL-1 from the cytosol to the mitochondria modulating ABT-737 sensitivity in small cell lung cancer.
24457957 Mantle cell lymphoma are characterized by high constitutive NOXA gene expression but low levels of NOXA protein.
24387758 Parthenolide triggers extrinsic apoptosis by up-regulating TNFRSF10B and intrinsic apoptosis through increasing the expression of PMAIP1.
23828551 Knockdown of TRAIL and Noxa reduced FOXO3-induced apoptosis, implicating that mitochondrial destabilization amplifies TRAIL-signaling.
23798675 CXCR4 chemokine receptor signaling induces apoptosis in acute myeloid leukemia cells via regulation of the Bcl-2 family members Bcl-XL, Noxa, and Bak.
23770082 Overall, these data reveal a Noxa-mediated signaling pathway that couples lysosomal membrane permeabilization with mitochondrial outer membrane permeabilization and ultimate apoptosis during oxidative stress.
23684722 Physalin A-induced apoptosis was triggered by activation of p53-Noxa pathway.
23429261 caspases contribute to trigger the mitochondrial apoptotic pathway by coupling Bcl-2/Bcl-xL inhibition to that of Mcl-1, via the pRb/E2F-1-dependent induction of Noxa
23302226 Noxa is a central determinant of hypersensitivity to cisplatin
23300762 Vorinostat, is able to ablate the multicellular resistance to bortezomib by its ability to restore expression of a key pro-apoptotic Bcl-2 family member, Noxa.
23014529 Oncolytic viruses selectively induced expression of TRAIL and Noxa in prostate cancer cells, lung cancer cells, and breast cancer cells downstream of RIG-I and MAVS.
22718761 detailed analysis of the Noxa promoter revealed that p73 and Sp1-like factors, Sp1 and KLF6, played key roles in the transcriptional control of this gene
22615771 show that miR-200c is a novel negative regulator of the pro-apoptotic Bcl-2 family member Noxa
22590594 these data suggest a new mechanism by which NOXA chemosensitized ovarian cancer cells to cisplatin by inducing alterations in the Bax/Smac axis.
22548841 Our results suggested that polymorphisms of NOXA and MCL1 may modify the risk of HPV16-associated oropharyngeal cancer.
22446329 these study suggested that the four mutations lowered the stability of the p53 DBD domain and induced aggregation of structurally destabilized p53, and thus disrupted the p53-PUMA/NOXA interaction.
22430213 Novel but opposing roles for the p53 and TAp73 in the induction of Noxa and Bim and regulation of apoptosis.
22361683 NOXA, a sensor of proteasome integrity, is degraded by 26S proteasomes by an ubiquitin-independent pathway that is blocked by MCL-1.
22245094 during skin hypoxia, promotes UVB-induced apoptosis in keratinocytes
22216287 siRNA-mediated knockdown of Noxa resulted in cell cycle arrest following E2 treatment, indicating that Noxa expression is required for cell cycle progression in ER-positive breast cancer cells.
21911456 Noxa is critical for sensitivity to cell death induced by 2-deoxyglucose. This is the first evidence of the implication of a BH3-only protein in death induced by 2-DG.
21907705 Noxa triggers the degradation of Mcl-1 at the mitochondria according to the exclusive location of Noxa at this compartment.
21698224 A pathway leading from the detection of viral RNA during modified vaccinia virus infection by the cytosolic helicase-pathway, to the up-regulation of Noxa and apoptosis via IRF3 and type I IFN signalling.
21628457 Multiple BH3 mimetics antagonize antiapoptotic MCL1 protein by inducing the endoplasmic reticulum stress response and up-regulating BH3-only protein NOXA.
21518486 Bortezomib can enhance sensitivity of NB4 cells to apoptosis induced by As(2)O(3) which may be related to up-regulation of proapoptotic protein NOXA.
21516346 Noxa/Mcl-1 balance is regulated by glucose deprivation as well as by general metabolic stress
21454712 Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells.
21353614 Ras-induced expression of Noxa and Beclin-1 promotes autophagic cell death, which represents a mechanism to limit the oncogenic potential of deregulated Ras signals.
21153863 Expression of p53-inducible BH3-only apoptotic proteins Puma and Noxa was elevated and large activation of executive caspases was observed.
21145489 The proapoptotic function of Noxa in human leukemia cells is regulated by the kinase Cdk5 and by glucose
21113147 Noxa participates in triggering mitochondrial dysfunction in multiple apoptotic pathways through distinct mechanisms
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20935673 Noxa RNA-interference markedly decreased sensitivity to CDDP/F-ara-A, supporting a key role for Noxa as mediator between ROS signaling and apoptosis induction.
20802529 These observations reveal a novel ERK-regulated route to Noxa expression that is important for the cell killing activity of platinum-based chemotherapeutic drugs.
20393480 the pro-apoptotic mechanisms orchestrated by p38(MAPK) in human keratinocytes in response to ultraviolet rays B involve an HIF-1/Noxa axis
20223826 results suggest that the loss/inactivation of Mcl-1 in conjunction with an induced Noxa/Bcl-xL interaction may serve as a trigger for mitochondrial dysfunction during DNA damage-induced apoptosis
20156337 Glucocorticoid Response Elements (GREs) within the promoter regulatory regions of the Bcl-2 family members NOXA and Mcl-1 were identified, indicating that they are direct GR transcriptional targets.
20085765 Data show H2O2-induced caspase-dependent apoptosis was strongly suppressed by silencing of Noxa, indicating that Noxa plays a crucial role in this form of apoptosis.
20051518 Data suggest that MCL1 steady-state expression levels do not affect sensitivity to proteasome-inhibitor treatment in neuronal tumor cells, and that both the repression of Bcl-xL and the activation of Noxa are necessary for bortezomib-induced cell death.
19815839 Data show that both Akt inhibitors decreased MCL-1 protein level, increased PUMA and NOXA protein levels, and induced apoptosis irrespective of TP53 status.
19540835 Results provide novel insight into the role of Noxa in mitochondrial dynamics and cell death.
19515722 PAS may represent a novel class of drug that induces apoptosis in CLL cells independently of p53 status by a mechanism involving Noxa up-regulation.
19452318 T(reg) cells in CLL may accumulate both by increased formation, facilitated by CD27-CD70 interaction in the lymph node proliferation centres, and decreased sensitivity to apoptosis because of a shifted Noxa-Bcl-2 balance
19372561 Increased Noxa Expression Results in Increased Sensitivity to ABT-737 in small cell lung cancer.
19298224 Therapeutic potential of proapoptotic molecule NOXA in the selective elimination of tumor cells is reported.
19269851 expression is regulated via binding with Bmi1; involved in Th2 memory cell survival
19164757 ERAD inhibitors integrate ER stress with an epigenetic mechanism to activate BH3-only protein NOXA in cancer cells
19148187 Depletion of Noxa by short hairpin RNA protected cells from hyperthermia by preventing Mcl-1 degradation.
19050264 HIV-1 Tat upregulates NOXA expression in Tat-infected Jurkat T cells
18784742 In 12 CLL patients, the ratio of Noxa/actin band intensities increased from 2.9-fold to 40.3-fold after hyperforin treatment, compared to untreated controls, whereas this ratio did not change upon flavopiridol exposure.
18708163 hMTH1 plays an important role in protecting cells against H(2)O(2)-induced apoptosis via a Noxa- and caspase-3/7-mediated signaling pathway, thus conferring a survival advantage through the inhibition of oxidative-stress-induced DNA damage
18630524 Two splicing variants of the human Noxa geneare identified, which consists of three exons and two introns. Alternative splicing of exon 2 yields three transcripts. Transcript-1 joins exons 1 and 3 to encode Noxa of 54 amino acids.
18408751 the involvement of multiple pathways in Noxa-induced apoptosis that are triggered at mitochondria and the endoplasmic reticulum
18398749 At higher concentrations of bortezomib, however, Noxa was also upregulated in resistant cells and this effect was sufficient to induce apoptosis.
18354037 Noxa expression was enhanced by GSH depletion and inhibited by increasing GSH levels in the multiple myeloma cells
18231856 PMAIP1 may play an important role in the progression of pancreatic cancer.
18192275 Interferon gamma induces XAF1 and Noxa expression and potentiates apoptosis by STAT3 activation
17227835 GX15-070 synergizes with bortezomib in mantle cell lymphoma by enhancing Noxa-mediated activation of Bak.
17216584 These data demonstrate the importance of Noxa induction in determining the apoptotic response to fenretinide and emphasise the role of Noxa in p53-independent apoptosis.
17038534 suppression of Noxa in the lymph node environment contributes to the persistence of B-CLL at these sites and suggest that therapeutic targeting of Noxa might be beneficial
16928686 functional eIF2alpha played an essential role in PS-341-induced Noxa expression
16888645 We conclude that Noxa and Bim establish a connection between FKHRL1 and mitochondria, and that both BH3-only proteins are critically involved in FKHRL1-induced apoptosis in neuroblastoma.
16782027 Noxa/Mcl-1 axis is an apoptosis rheostat in dividing cells, in a selective pathway that functions to restrain lymphocyte expansion and can be triggered by glucose deprivation
15705586 component of the innate immune response of cells to viral infection, leading to enhanced cellular apoptosis
15572378 E1A activation of p73 and the p53 apoptotic target Noxa can occur in the absence of a functional p53
15299072 p53 activation is not necessary for up-regulation of NOXA in melanoma cells
15102863 BOK and NOXA are essential mediators of p53-dependent apoptosis
14699081 Noxa promoter responds directly to hypoxia via hypoxia-inducible factor (HIF)-1alpha.
14500711 Noxa-induced mitochondrial dysfunction has a role in p53-mediated cell death
12879012 Noxa may not be of importance in the development of colorectal cancer

AA Sequence

MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT                      1 - 54
//

Text Mined References (104)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26497683 2015 A novel prohibitin-binding compound induces the mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26422397 2015 SATB1 Mediates Long-Range Chromatin Interactions: A Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes.
25975837 2015 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25922916 2015 The NOXA-MCL1-BIM axis defines lifespan on extended mitotic arrest.
25829494 2015 Heat shock inhibition of CDK5 increases NOXA levels through miR-23a repression.
25714012 2015 Harnessing Noxa demethylation to overcome Bortezomib resistance in mantle cell lymphoma.
25429623 2014 The elimination of miR-23a in heat-stressed cells promotes NOXA-induced cell death and is prevented by HSP70.
25404713 2015 Regulation of Noxa-mediated apoptosis in Helicobacter pylori-infected gastric epithelial cells.
25365078 2014 Noxa upregulation by oncogenic activation of MEK/ERK through CREB promotes autophagy in human melanoma cells.
25210795 2014 The ratio of Mcl-1 and Noxa determines ABT737 resistance in squamous cell carcinoma of the skin.
24991768 2014 Usp9x- and Noxa-mediated Mcl-1 downregulation contributes to pemetrexed-induced apoptosis in human non-small-cell lung cancer cells.
24901046 2014 Apolipoprotein L2 contains a BH3-like domain but it does not behave as a BH3-only protein.
24811167 2014 The carboxyl-terminal tail of Noxa protein regulates the stability of Noxa and Mcl-1.
24525728 2014 Noxa determines localization and stability of MCL-1 and consequently ABT-737 sensitivity in small cell lung cancer.
24457957 2014 Discrepant NOXA (PMAIP1) transcript and NOXA protein levels: a potential Achilles' heel in mantle cell lymphoma.
24387758 2014 Parthenolide induces apoptosis via TNFRSF10B and PMAIP1 pathways in human lung cancer cells.
23828551 2013 Therapy-resistant acute lymphoblastic leukemia (ALL) cells inactivate FOXO3 to escape apoptosis induction by TRAIL and Noxa.
23798675 2013 CXCR4 chemokine receptor signaling induces apoptosis in acute myeloid leukemia cells via regulation of the Bcl-2 family members Bcl-XL, Noxa, and Bak.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23770082 2013 Noxa couples lysosomal membrane permeabilization and apoptosis during oxidative stress.
23684722 2013 Physalin A induces apoptosis via p53-Noxa-mediated ROS generation, and autophagy plays a protective role against apoptosis through p38-NF-?B survival pathway in A375-S2 cells.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23429261 2013 pRb/E2F-1-mediated caspase-dependent induction of Noxa amplifies the apoptotic effects of the Bcl-2/Bcl-xL inhibitor ABT-737.
23302226 2013 Cisplatin hypersensitivity of testicular germ cell tumors is determined by high constitutive Noxa levels mediated by Oct-4.
23300762 2012 Vorinostat eliminates multicellular resistance of mesothelioma 3D spheroids via restoration of Noxa expression.
23014529 2012 TRAIL and Noxa are selectively upregulated in prostate cancer cells downstream of the RIG-I/MAVS signaling pathway by nonreplicating Sendai virus particles.
22718761 2012 Transcription factors Sp1 and p73 control the expression of the proapoptotic protein NOXA in the response of testicular embryonal carcinoma cells to cisplatin.
22615771 2012 MiR-200c regulates Noxa expression and sensitivity to proteasomal inhibitors.
22590594 2012 NOXA-induced alterations in the Bax/Smac axis enhance sensitivity of ovarian cancer cells to cisplatin.
22548841 2012 Genetic variants of NOXA and MCL1 modify the risk of HPV16-associated squamous cell carcinoma of the head and neck.
22446329 2012 In vitro binding properties of tumor suppressor p53 with PUMA and NOXA.
22430213 2013 N-(phosphonacetyl)-L-aspartate induces TAp73-dependent apoptosis by modulating multiple Bcl-2 proteins: potential for cancer therapy.
22361683 2012 NOXA, a sensor of proteasome integrity, is degraded by 26S proteasomes by an ubiquitin-independent pathway that is blocked by MCL-1.
22245094 2012 Skin mild hypoxia enhances killing of UVB-damaged keratinocytes through reactive oxygen species-mediated apoptosis requiring Noxa and Bim.
22216287 2011 Estrogen-mediated upregulation of Noxa is associated with cell cycle progression in estrogen receptor-positive breast cancer cells.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21911456 2011 2-deoxyglucose induces Noxa-dependent apoptosis in alveolar rhabdomyosarcoma.
21907705 2011 Noxa controls Mule-dependent Mcl-1 ubiquitination through the regulation of the Mcl-1/USP9X interaction.
21698224 2011 Induction of Noxa-mediated apoptosis by modified vaccinia virus Ankara depends on viral recognition by cytosolic helicases, leading to IRF-3/IFN-?-dependent induction of pro-apoptotic Noxa.
21628457 2011 Multiple BH3 mimetics antagonize antiapoptotic MCL1 protein by inducing the endoplasmic reticulum stress response and up-regulating BH3-only protein NOXA.
21525171 2011 Bortezomib primes glioblastoma, including glioblastoma stem cells, for TRAIL by increasing tBid stability and mitochondrial apoptosis.
21518486 2011 [NB4 cell apoptosis induced by bortezomib combined with As(2)O(3) and its mechanism].
21516346 2011 Apoptosis induced by overall metabolic stress converges on the Bcl-2 family proteins Noxa and Mcl-1.
21454712 2011 Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells.
21353614 2011 Oncogenic Ras-induced expression of Noxa and Beclin-1 promotes autophagic cell death and limits clonogenic survival.
21153863 2011 Decitabine-induced apoptosis is derived by Puma and Noxa induction in chronic myeloid leukemia cell line as well as in PBL and is potentiated by SAHA.
21145489 2010 The proapoptotic function of Noxa in human leukemia cells is regulated by the kinase Cdk5 and by glucose.
21132008 2011 Mcl-1 is critical for survival in a subgroup of non-small-cell lung cancer cell lines.
21113147 2011 Selective involvement of BH3-only proteins and differential targets of Noxa in diverse apoptotic pathways.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20935673 2011 ROS-mediated upregulation of Noxa overcomes chemoresistance in chronic lymphocytic leukemia.
20810912 2010 Hypoxia downregulates p53 but induces apoptosis and enhances expression of BAD in cultures of human syncytiotrophoblasts.
20802529 2010 An ERK-dependent pathway to Noxa expression regulates apoptosis by platinum-based chemotherapeutic drugs.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20393480 2010 A p38(MAPK)/HIF-1 pathway initiated by UVB irradiation is required to induce Noxa and apoptosis of human keratinocytes.
20223826 2010 Perturbation of the Bcl-2 network and an induced Noxa/Bcl-xL interaction trigger mitochondrial dysfunction after DNA damage.
20156337 2010 The role of glucocorticoid receptor phosphorylation in Mcl-1 and NOXA gene expression.
20085765 2010 Noxa is necessary for hydrogen peroxide-induced caspase-dependent cell death.
20051518 2010 The anti-apoptotic protein BCL2L1/Bcl-xL is neutralized by pro-apoptotic PMAIP1/Noxa in neuroblastoma, thereby determining bortezomib sensitivity independent of prosurvival MCL1 expression.
19815839 2009 Akt inhibitors induce apoptosis in chronic lymphocytic leukemia cells.
19540835 2009 Effects of the BH3-only protein human Noxa on mitochondrial dynamics.
19515722 2009 2-Phenylacetylenesulfonamide (PAS) induces p53-independent apoptotic killing of B-chronic lymphocytic leukemia (CLL) cells.
19452318 2009 Enhanced formation and survival of CD4+ CD25hi Foxp3+ T-cells in chronic lymphocytic leukemia.
19372561 2009 Alterations in the Noxa/Mcl-1 axis determine sensitivity of small cell lung cancer to the BH3 mimetic ABT-737.
19298224 2009 Therapeutic potential of proapoptotic molecule Noxa in the selective elimination of tumor cells.
19269851 2009 Critical role of the Polycomb and Trithorax complexes in the maintenance of CD4 T cell memory.
19164757 2009 ERAD inhibitors integrate ER stress with an epigenetic mechanism to activate BH3-only protein NOXA in cancer cells.
19148187 2009 Regulation of heat-induced apoptosis by Mcl-1 degradation and its inhibition by Hsp70.
18784742 2009 Noxa upregulation is associated with apoptosis of chronic lymphocytic leukemia cells induced by hyperforin but not flavopiridol.
18708163 2008 hMTH1 depletion promotes oxidative-stress-induced apoptosis through a Noxa- and caspase-3/7-mediated signaling pathway.
18630524 Identification and characterization of two splicing variants of human Noxa.
18408751 2008 The BH3-only member Noxa causes apoptosis in melanoma cells by multiple pathways.
18398749 2008 Noxa mediates bortezomib induced apoptosis in both sensitive and intrinsically resistant mantle cell lymphoma cells and this effect is independent of constitutive activity of the AKT and NF-kappaB pathways.
18354037 2008 BH3-only proteins Noxa, Bmf, and Bim are necessary for arsenic trioxide-induced cell death in myeloma.
18231856 2008 The PMAIP1 gene on chromosome 18 is a candidate tumor suppressor gene in human pancreatic cancer.
18192275 2008 Interferon-gamma induces X-linked inhibitor of apoptosis-associated factor-1 and Noxa expression and potentiates human vascular smooth muscle cell apoptosis by STAT3 activation.
17599062 2007 CDIP, a novel pro-apoptotic gene, regulates TNFalpha-mediated apoptosis in a p53-dependent manner.
17389404 2007 Structural insights into the degradation of Mcl-1 induced by BH3 domains.
17374615 2007 Functional linkage between NOXA and Bim in mitochondrial apoptotic events.
17289999 2007 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak.
17227835 2007 The BH3-mimetic GX15-070 synergizes with bortezomib in mantle cell lymphoma by enhancing Noxa-mediated activation of Bak.
17216584 2007 Role of Noxa in p53-independent fenretinide-induced apoptosis of neuroectodermal tumours.
17038534 2007 Differential Noxa/Mcl-1 balance in peripheral versus lymph node chronic lymphocytic leukemia cells correlates with survival capacity.
17024184 2006 Differential contribution of Puma and Noxa in dual regulation of p53-mediated apoptotic pathways.
16928686 2006 Proteasome inhibitor PS-341 induces apoptosis in cisplatin-resistant squamous cell carcinoma cells by induction of Noxa.
16888645 2007 FKHRL1-mediated expression of Noxa and Bim induces apoptosis via the mitochondria in neuroblastoma cells.
16782027 2006 The Noxa/Mcl-1 axis regulates susceptibility to apoptosis under glucose limitation in dividing T cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15901672 2005 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins.
15705586 2005 Involvement of Noxa in cellular apoptotic responses to interferon, double-stranded RNA, and virus infection.
15694340 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function.
15572378 2005 E1A activates transcription of p73 and Noxa to induce apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15299072 2004 p53-independent NOXA induction overcomes apoptotic resistance of malignant melanomas.
15102863 2004 BOK and NOXA are essential mediators of p53-dependent apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699081 2004 BH3-only protein Noxa is a mediator of hypoxic cell death induced by hypoxia-inducible factor 1alpha.
14500711 2003 The molecular mechanism of Noxa-induced mitochondrial dysfunction in p53-mediated cell death.
12879012 2003 Noxa in colorectal cancer: a study on DNA, mRNA and protein expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10807576 2000 Noxa, a BH3-only member of the Bcl-2 family and candidate mediator of p53-induced apoptosis.
2398525 1990 Molecular cloning and characterization of a cDNA for a novel phorbol-12-myristate-13-acetate-responsive gene that is highly expressed in an adult T-cell leukemia cell line.