Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.008 7.4e-03
active ulcerative colitis -1.028 3.3e-02
acute quadriplegic myopathy 2.240 6.0e-07
adult high grade glioma 1.300 2.1e-02
Amyotrophic lateral sclerosis 1.544 4.3e-07
atypical teratoid / rhabdoid tumor 1.400 1.3e-04
Breast cancer -2.600 1.2e-07
breast carcinoma -1.500 1.2e-18
ependymoma 1.200 2.2e-02
glioblastoma 1.200 5.3e-05
group 4 medulloblastoma 1.500 1.7e-02
invasive ductal carcinoma -1.400 7.3e-03
juvenile dermatomyositis 1.024 7.2e-08
lung carcinoma 1.100 1.8e-17
medulloblastoma, large-cell 1.600 5.0e-03
oligodendroglioma 1.100 1.3e-02
Pilocytic astrocytoma 1.100 1.3e-02
primitive neuroectodermal tumor 1.200 3.0e-03
tuberculosis and treatment for 6 months 1.100 8.3e-06

Gene RIF (1)

AA Sequence

MRPGGERPVEGGACNGRSELELLKLRSAECIDEAAERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREP      1 - 70
PAASWAVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHNLIAEVGAAAALGV     71 - 140
RGALEGLPRPPPPVKVVVLGTPAEEDGGGKIDLIEAGAFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKY    141 - 210
YGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSM    211 - 280
KELQVLTKKAEDCFRAAALASGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSG    281 - 350
STDFGNVSFVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIRE    351 - 420
DFKLKLQEEQFVNAVE                                                          421 - 436
//

Text Mined References (9)

PMID Year Title