Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.14
PubTator Score 15.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
chronic lymphocytic leukemia -1.939 5.0e-05
malignant mesothelioma 1.200 5.1e-04
psoriasis -2.600 2.3e-05
osteosarcoma 1.905 8.8e-03
medulloblastoma 2.100 1.4e-03
atypical teratoid / rhabdoid tumor 2.200 1.6e-04
glioblastoma 1.700 7.9e-03
medulloblastoma, large-cell -2.700 1.3e-03
adrenocortical carcinoma 1.704 6.9e-05
tuberculosis 1.500 3.2e-06
primary pancreatic ductal adenocarcinoma 1.243 2.2e-03
lung cancer -3.000 5.5e-06
active Crohn's disease 1.414 1.3e-02
sarcoidosis 1.500 2.0e-02
diabetes mellitus -1.200 2.8e-03
interstitial cystitis 1.900 1.2e-03
primary Sjogren syndrome 2.200 2.5e-04
invasive ductal carcinoma 1.499 3.9e-03
COPD 1.200 4.2e-02
gastric carcinoma 2.200 1.6e-02
ulcerative colitis 2.300 1.0e-04
ovarian cancer -1.900 1.9e-06
pancreatic cancer 1.100 3.4e-03
head and neck cancer -1.200 3.5e-03

Gene RIF (6)

PMID Text
23160370 loss of Plexin C1 in melanoma may promote early steps in melanoma progression through suppression of migration and proliferation
20727575 Study reports the structures of Sema7A and A39R complexed with the Semaphorin-binding module of PlexinC1; both structures show two PlexinC1 molecules symmetrically bridged by Semaphorin dimers.
19318806 significant loss of Plexin C1 in metastatic melanoma compared with primary melanoma, suggesting the possibility that the Plexin C1 receptor is a tumor suppressor protein for melanoma
18987670 Plexin C1, a receptor for semaphorin 7a, inactivates cofilin and is a potential tumor suppressor for melanoma progression.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17671519 GTP-bound form of Rab7 promotes melanogenesis through the regulation of gp100 maturation in melanoma cells.

AA Sequence

MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASQEDGVFVASGSCLDQLDY      1 - 70
SLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLGGLLLTGWTFDRGACEVRPLG     71 - 140
NLSRNSLRNGTEVVSCHPQGSTAGVVYRAGRNNRWYLAVAATYVLPEPETASRCNPAASDHDTAIALKDT    141 - 210
EGRSLATQELGRLKLCEGAGSLHFVDAFLWNGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQAS    211 - 280
LDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTA    281 - 350
ESHCKEGDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIK    351 - 420
EETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQRCTFQGDCVHS    421 - 490
ENLENWLDISSGAKKCPKIQIIRSSKEKTTVTMVGSFSPRHSKCMVKNVDSSRELCQNKSQPNRTCTCSI    491 - 560
PTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLKECPACVETGCAWCKSARRCIHPFTACDPSDYERN    561 - 630
QEQCPVAVEKTSGGGRPKENKGNRTNQALQVFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGT    631 - 700
STCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQ    701 - 770
NITMMGRNFDVIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQY    771 - 840
REDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDLTTILCKIK    841 - 910
GIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQ    911 - 980
LELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKN    981 - 1050
ESLTALDALICNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNM   1051 - 1120
QPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLL   1121 - 1190
WQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLEL   1191 - 1260
QMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAF   1261 - 1330
QDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKI   1331 - 1400
TDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLL   1401 - 1470
YAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLE   1471 - 1540
RERGLEEAQKQLLHVKVLFDEKKKCKWM                                             1541 - 1568
//

Text Mined References (20)

PMID Year Title
23518928 2013 TSPYL5 SNPs: association with plasma estradiol concentrations and aromatase expression.
23468962 2013 A genome-wide scan for breast cancer risk haplotypes among African American women.
23160370 2013 The neural guidance receptor Plexin C1 delays melanoma progression.
21610070 2011 Structural basis of Rnd1 binding to plexin Rho GTPase binding domains (RBDs).
20727575 2010 Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1.
19946888 2010 Defining the membrane proteome of NK cells.
19792857 2009 Mechanical tension alters semaphorin expression in the periodontium.
19462467 2009 Molecular profiling of the "plexinome" in melanoma and pancreatic cancer.
19318806 2009 The semaphorin 7A receptor Plexin C1 is lost during melanoma metastasis.
18987670 2009 Plexin C1, a receptor for semaphorin 7a, inactivates cofilin and is a potential tumor suppressor for melanoma progression.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
17910043 2008 Identification of genes with abnormal expression changes in acute myeloid leukemia.
17671519 2008 Semaphorin 7a promotes spreading and dendricity in human melanocytes through beta1-integrins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15746246 2005 Soluble CD100 functions on human monocytes and immature dendritic cells require plexin C1 and plexin B1, respectively.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10520995 1999 Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.
9586637 1998 A poxvirus-encoded semaphorin induces cytokine production from monocytes and binds to a novel cellular semaphorin receptor, VESPR.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.