Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.39
PubTator Score 40.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 2.700 1.3e-03
ependymoma 2.300 2.4e-03
oligodendroglioma 1.600 1.1e-03
psoriasis 2.700 1.9e-05
glioblastoma multiforme 1.100 3.7e-24
osteosarcoma 1.612 1.0e-03
chronic lymphosyte leukemia -1.200 1.9e-08
medulloblastoma 1.900 5.9e-05
atypical teratoid / rhabdoid tumor 1.300 3.1e-04
primitive neuroectodermal tumor 1.400 9.6e-03
Duchenne muscular dystrophy 1.243 4.6e-09
autosomal dominant Emery-Dreifuss muscul... 1.062 1.6e-03
juvenile dermatomyositis 1.296 1.3e-10
acute quadriplegic myopathy 1.122 3.2e-06
primary pancreatic ductal adenocarcinoma 1.158 4.8e-03
diabetes mellitus -1.100 1.1e-02
ovarian cancer 2.300 1.8e-06
pancreatic cancer 1.100 4.2e-03

Gene RIF (8)

PMID Text
26627240 Two related guanine nucleotide exchange factors (GEFs), PDZ-RhoGEF and leukemia-associated RhoGEF (LARG), use their PDZ domains to bind class B plexins and play critical roles in signaling.
26275342 Blocking of CD100, plexin B1 and/or B2 in adhesion experiments have shown that both CD100 and plexins act as adhesion molecules involved in monocyte-endothelial cell binding.
26035216 Results show that decreased expression of Sema4D, plexin-B1 and -B2 was associated with local recurrence and poor prognosis of breast neoplasm.
25762646 Plexin-B2 promotes glioma invasion and vascularization
25237006 In endometrial luminal epithelium, cadherin 6, desmoglein 2 and plexin b2 were surprisingly found in the apical as well as the lateral membrane domain; their knock-down compromised epithelial integrity.
24158112 High PLEXIN B2 expression is associated with high-grade gliomas.
12533544 cleavage by proprotein convertases is a novel regulatory step for semaphorin receptors localized at the cell surface.
12183458 Plexin B2 associates directly with two members of a recently identified family of Dbl homology/pleckstrin homology containing guanine nucleotide exchange factors for Rho, PDZ-RhoGEF, and Leukemia-associated Rho GEF (LARG).

AA Sequence

MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATG      1 - 70
PALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGE     71 - 140
KSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNGIIVSTRLLDRTDSREAFEAYTDHATYKAGY    141 - 210
LSTNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCL    211 - 280
AASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQ    281 - 350
CGGHAPGSSKSFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYL    351 - 420
TPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCV    421 - 490
VEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLTVSPLPALSEEDELLCLFGES    491 - 560
PPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISC    561 - 630
VSNRWTCQWDLRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSL    631 - 700
HVGSDLLKFMEPVTMQESGTFAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLC    701 - 770
RAANPDYRCAWCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISV    771 - 840
AGRNCSFQPERYSVSTRIVCVIEAAETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSVEPQQGPQAGG    841 - 910
TTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQMLLEVSYGGSPVPNPGIFFTYR    911 - 980
ENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIAEPLQSWQPPREAESLQPMTVVGTDYVFHND    981 - 1050
TKVVFLSPAVPEEPEAYNLTVLIEMDGHRALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLN   1051 - 1120
KAMTLQEAEAFVGAERCTMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYD   1121 - 1190
TRVSDVPLSLILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEM   1191 - 1260
EDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFSNLLNSKSFLI   1261 - 1330
NFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERM   1331 - 1400
LSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ   1401 - 1470
DEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWK   1471 - 1540
RVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKE   1541 - 1610
KERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWK   1611 - 1680
TNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKK   1681 - 1750
MVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQL   1751 - 1820
AFRLQQIAAALENKVTDL                                                       1821 - 1838
//

Text Mined References (29)

PMID Year Title
26627240 2015 Secondary PDZ domain-binding site on class B plexins enhances the affinity for PDZ-RhoGEF.
26275342 2015 CD100 and plexins B2 and B1 mediate monocyte-endothelial cell adhesion and might take part in atherogenesis.
26035216 2015 Reduced expression of semaphorin 4D and plexin-B in breast cancer is associated with poorer prognosis and the potential linkage with oestrogen receptor.
25762646 2015 Plexin-B2 promotes invasive growth of malignant glioma.
25237006 2015 Endometrial apical glycoproteomic analysis reveals roles for cadherin 6, desmoglein-2 and plexin b2 in epithelial integrity.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24158112 2013 Experimental validation of 5 in-silico predicted glioma biomarkers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16122393 2005 Plexin B3 promotes neurite outgrowth, interacts homophilically, and interacts with Rin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184888 2004 Interplay between scatter factor receptors and B plexins controls invasive growth.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12533544 2003 Functional regulation of semaphorin receptors by proprotein convertases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12183458 2002 Plexin B regulates Rho through the guanine nucleotide exchange factors leukemia-associated Rho GEF (LARG) and PDZ-RhoGEF.
10591208 1999 The DNA sequence of human chromosome 22.
10520995 1999 Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8593609 1995 An expression-independent catalog of genes from human chromosome 22.
7889532 1995 Identification and partial sequence of a cDNA that is differentially expressed in human brain tumors.