Property Summary

NCBI Gene PubMed Count 65
PubMed Score 64.53
PubTator Score 194.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neurodevelopmental Disorders 70 0.0 0.0
Disease Target Count P-value
ovarian cancer 8297 5.7e-06
osteosarcoma 7766 6.0e-05
Down syndrome 480 2.7e-04
ependymoma 4559 9.3e-04
oligodendroglioma 2768 1.2e-03
astrocytic glioma 2530 3.3e-02
subependymal giant cell astrocytoma 2230 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.1
Kidney cancer 2548 0.0 0.5
Disease Target Count Z-score Confidence
Prostate cancer 164 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2388 3.106 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 3.3e-02
Down syndrome 1.400 2.7e-04
ependymoma 2.000 9.3e-04
oligodendroglioma 1.500 1.2e-03
osteosarcoma 1.256 6.0e-05
ovarian cancer -1.200 5.7e-06
subependymal giant cell astrocytoma -1.098 3.5e-02

Protein-protein Interaction (5)

Gene RIF (50)

AA Sequence

MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVST      1 - 70
GPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDT     71 - 140
QYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGR    141 - 210
LSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAA    211 - 280
VATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDG    281 - 350
TEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF    351 - 420
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCAS    421 - 490
CLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMSPANISREETREVFLSVPDLP    491 - 560
PLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFYDCV    561 - 630
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKA    631 - 700
LATPAPDTLPVEPGAPSTATASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGT    701 - 770
AVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD    771 - 840
WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGLWELEEATLGA    841 - 910
SSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLEVVVEARVECEPPPDTQCHVT    911 - 980
CQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWCEGERPR    981 - 1050
CVTREACGEAEAVATQCPAPLIHSVEPLTGPVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEY   1051 - 1120
EVSSSLVCITGASGEEVAGATAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTG   1121 - 1190
RLEDIRVVVGDQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT   1191 - 1260
KSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSSQQFEEPCHVN   1261 - 1330
SSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTLQPLNPEDPTMPFRHKPGSVF   1331 - 1400
SVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPRHHALREAPDSLPEFTVQMGNLRF   1401 - 1470
SLGHVQYDGESPGAFPVAAQVGLGVGTSLLALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRC   1471 - 1540
KKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLL   1541 - 1610
NSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE   1611 - 1680
TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLT   1681 - 1750
LNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDE   1751 - 1820
DVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPS   1821 - 1890
DEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDE   1891 - 1960
QAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRD   1961 - 2030
SPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYD   2031 - 2100
QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL                                      2101 - 2135
//

Text Mined References (71)

PMID Year Title