Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.78
PubTator Score 145.84

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.500 1.1e-03
psoriasis -2.600 1.7e-05
osteosarcoma -3.919 1.5e-11
medulloblastoma 2.900 3.9e-04
atypical teratoid / rhabdoid tumor 2.000 1.2e-05
glioblastoma 2.600 4.8e-06
medulloblastoma, large-cell 2.400 1.5e-05
primitive neuroectodermal tumor 1.900 4.5e-05
pediatric high grade glioma 1.800 1.9e-04
pilocytic astrocytoma 1.200 7.1e-03
Breast cancer 1.100 8.4e-12

Gene RIF (3)

PMID Text
25518740 Data indicate that plexin A1-4 (PLXNA1-4) mediation of neuroanatomical traits can be detected using in vivo neuroimaging techniques.
21925246 in vitro analysis on PLXNA3 also suggest that this gene may have some form of growth suppressive role in breast cancer, in addition to a similar role for the gene previously reported in ovarian cancer.
19480842 Data show that the expression of Sema3A receptors (neuropilin-1 (NRP-1), NRP-2, plexin A1, plexin A2, and plexin A3) significantly increased during M-CSF-mediated differentiation of monocytes into macrophages.

AA Sequence

MPSVCLLLLLFLAVGGALGNRPFRAFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPNLTELRAHVTGP      1 - 70
VEDNARCYPPPSMRVCAHRLAPVDNINKLLLIDYAARRLVACGSIWQGICQFLRLDDLFKLGEPHHRKEH     71 - 140
YLSGAQEPDSMAGVIVEQGQGPSKLFVGTAVDGKSEYFPTLSSRKLISDEDSADMFSLVYQDEFVSSQIK    141 - 210
IPSDTLSLYPAFDIYYIYGFVSASFVYFLTLQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPI    211 - 280
GCSWRGVEYRLVQSAHLAKPGLLLAQALGVPADEDVLFTIFSQGQKNRASPPRQTILCLFTLSNINAHIR    281 - 350
RRIQSCYRGEGTLALPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLHVIEGLPLLADSTDGMASVAAY    351 - 420
TYRQHSVVFIGTRSGSLKKVRVDGFQDAHLYETVPVVDGSPILRDLLFSPDHRHIYLLSEKQVSQLPVET    421 - 490
CEQYQSCAACLGSGDPHCGWCVLRHRCCREGACLGASAPHGFAEELSKCVQVRVRPNNVSVTSPGVQLTV    491 - 560
TLHNVPDLSAGVSCAFEAAAENEAVLLPSGELLCPSPSLQELRALTRGHGATRTVRLQLLSKETGVRFAG    561 - 630
ADFVFYNCSVLQSCMSCVGSPYPCHWCKYRHTCTSRPHECSFQEGRVHSPEGCPEILPSGDLLIPVGVMQ    631 - 700
PLTLRAKNLPQPQSGQKNYECVVRVQGRQQRVPAVRFNSSSVQCQNASYSYEGDEHGDTELDFSVVWDGD    701 - 770
FPIDKPPSFRALLYKCWAQRPSCGLCLKADPRFNCGWCISEHRCQLRTHCPAPKTNWMHLSQKGTRCSHP    771 - 840
RITQIHPLVGPKEGGTRVTIVGDNLGLLSREVGLRVAGVRCNSIPAEYISAERIVCEMEESLVPSPPPGP    841 - 910
VELCVGDCSADFRTQSEQVYSFVTPTFDQVSPSRGPASGGTRLTISGSSLDAGSRVTVTVRDSECQFVRR    911 - 980
DAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTAITVSGTHLLT    981 - 1050
VQEPRVRAKYRGIETTNTCQVINDTAMLCKAPGIFLGRPQPRAQGEHPDEFGFLLDHVQTARSLNRSSFT   1051 - 1120
YYPDPSFEPLGPSGVLDVKPGSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCSLTVSDTQLLCDSPSQTG   1121 - 1190
RQPVMVLVGGLEFWLGTLHISAERALTLPAMMGLAAGGGLLLLAITAVLVAYKRKTQDADRTLKRLQLQM   1191 - 1260
DNLESRVALECKEAFAELQTDINELTNHMDEVQIPFLDYRTYAVRVLFPGIEAHPVLKELDTPPNVEKAL   1261 - 1330
RLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYATGLLKQLLADLIEKNLESKNH   1331 - 1400
PKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLLYCAIKQQMEKGPIDAITGEARYSLSEDKLIR   1401 - 1470
QQIDYKTLTLHCVCPENEGSAQVPVKVLNCDSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMTR   1471 - 1540
IILQDEDVTTKIECDWKRLNSLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTASSPDS   1541 - 1610
LRSRAPMITPDQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTA   1611 - 1680
HRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSV   1681 - 1750
VAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMASISDQDMDAYLVEQSRLHASD   1751 - 1820
FSVLSALNELYFYVTKYRQEILTALDRDASCRKHKLRQKLEQIISLVSSDS                      1821 - 1871
//

Text Mined References (17)

PMID Year Title
25518740 2015 PlexinA polymorphisms mediate the developmental trajectory of human corpus callosum microstructure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21925246 2011 Semaphorin-plexin signalling genes associated with human breast tumourigenesis.
20138877 2010 Myeloid translocation gene 16b is a dual A-kinase anchoring protein that interacts selectively with plexins in a phospho-regulated manner.
19909241 2009 The role of neuropilins in cell signalling.
19480842 2009 Expression and function of semaphorin 3A and its receptors in human monocyte-derived macrophages.
15772651 2005 The DNA sequence of the human X chromosome.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
11604131 2001 Plexin signaling via off-track and rho family GTPases.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10520995 1999 Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.
8806646 1996 Identification of plexin family molecules in mice.
8733135 1996 Long-range sequence analysis in Xq28: thirteen known and six candidate genes in 219.4 kb of high GC DNA between the RCP/GCP and G6PD loci.
8570614 1996 A family of transmembrane proteins with homology to the MET-hepatocyte growth factor receptor.
8281148 1993 Construction of a transcription map of a 300 kb region around the human G6PD locus by direct cDNA selection.
8248200 1993 Transcriptional organization of a 450-kb region of the human X chromosome in Xq28.