Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.03
PubTator Score 3.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 2.000 1.7e-02
malignant mesothelioma -5.000 1.4e-08
oligodendroglioma -1.300 1.4e-02
osteosarcoma 1.222 1.8e-02
posterior fossa group A ependymoma 2.100 2.3e-09
astrocytoma 1.400 3.4e-02
atypical teratoid / rhabdoid tumor 1.300 1.0e-02
Atopic dermatitis -1.100 3.8e-03
primary pancreatic ductal adenocarcinoma 2.584 3.0e-03
tuberculosis 1.600 3.6e-05
intraductal papillary-mucinous adenoma (... -2.200 6.5e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.0e-02
Hydrolethalus syndrome -2.718 2.9e-02
lung cancer -2.100 8.6e-06
cystic fibrosis -1.600 3.6e-04
pilocytic astrocytoma 1.500 6.0e-06
sonic hedgehog group medulloblastoma 1.200 1.7e-02
subependymal giant cell astrocytoma 2.347 7.0e-03
invasive ductal carcinoma 1.460 1.3e-03
lung carcinoma -2.700 8.0e-42
Pick disease 1.900 1.4e-04
Breast cancer -1.700 4.6e-07
gastric carcinoma 1.600 1.7e-02
acute myeloid leukemia 1.500 2.5e-03
ovarian cancer -2.900 7.0e-11
pancreatic cancer 2.900 3.0e-03

Gene RIF (5)

PMID Text
25535841 PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
21310492 We identified a genetic association for susceptibility to retinopathy in 5 novel chromosomal regions and PLXDC2 and ARHGAP22, the latter 2 of which are genes implicated in endothelial cell angiogenesis and increased capillary permeability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSHRWKRNLD      1 - 70
FLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPSDSASRDLWVNIDQMEK     71 - 140
DKVKIHGILSNTHRQAARVNLSFDFPFYGHFLREITVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSV    141 - 210
SRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGL    211 - 280
SDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCS    281 - 350
KLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTS    351 - 420
LPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIIGILILVLIVATAILVTVYMYHHPTSAASIFFI    421 - 490
ERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC                                   491 - 529
//

Text Mined References (20)

PMID Year Title
25535841 2014 Identification of PLXDC1 and PLXDC2 as the transmembrane receptors for the multifunctional factor PEDF.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310492 2011 Genome-wide association study of diabetic retinopathy in a Taiwanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19625618 2009 Three susceptible loci associated with primary open-angle glaucoma identified by genome-wide association study in a Japanese population.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15574754 2004 Identification of a binding partner for the endothelial cell surface proteins TEM7 and TEM7R.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11559528 2001 Cell surface tumor endothelial markers are conserved in mice and humans.