Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.98
PubTator Score 3.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia 1.500 2.5e-03
astrocytoma 1.400 3.4e-02
Astrocytoma, Pilocytic 1.300 5.5e-07
Atopic dermatitis -1.100 3.8e-03
atypical teratoid / rhabdoid tumor 1.300 1.0e-02
Breast cancer -1.700 4.6e-07
cystic fibrosis -1.300 8.0e-05
ependymoma 1.100 5.4e-04
gastric carcinoma 1.500 3.4e-02
Hydrolethalus syndrome -2.538 4.8e-02
intraductal papillary-mucinous adenoma (... -2.200 6.5e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.0e-02
invasive ductal carcinoma 1.269 5.7e-03
lung cancer -1.900 3.1e-05
lung carcinoma -2.700 8.0e-42
malignant mesothelioma -5.000 1.4e-08
oligodendroglioma -1.300 1.4e-02
osteosarcoma 1.222 1.8e-02
ovarian cancer -2.000 1.9e-10
pancreatic cancer 2.900 3.0e-03
Pick disease 1.900 1.4e-04
primary pancreatic ductal adenocarcinoma 2.584 3.0e-03
Rheumatoid arthritis 2.000 1.7e-02
sonic hedgehog group medulloblastoma 1.200 1.7e-02
subependymal giant cell astrocytoma 2.320 1.1e-02
tuberculosis 1.600 3.6e-05

Gene RIF (6)

AA Sequence

MARFPKADLAAAGVMLLCHFFTDQFQFADGKPGDQILDWQYGVTQAFPHTEEEVEVDSHAYSHRWKRNLD      1 - 70
FLKAVDTNRASVGQDSPEPRSFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPSDSASRDLWVNIDQMEK     71 - 140
DKVKIHGILSNTHRQAARVNLSFDFPFYGHFLREITVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSV    141 - 210
SRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGL    211 - 280
SDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNRCGPCVSSQIGFNCSWCS    281 - 350
KLQRCSSGFDRHRQDWVDSGCPEESKEKMCENTEPVETSSRTTTTVGATTTQFRVLTTTRRAVTSQFPTS    351 - 420
LPTEDDTKIALHLKDNGASTDDSAAEKKGGTLHAGLIIGILILVLIVATAILVTVYMYHHPTSAASIFFI    421 - 490
ERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC                                   491 - 529
//

Text Mined References (21)

PMID Year Title