Property Summary

NCBI Gene PubMed Count 17
PubMed Score 80.33
PubTator Score 20.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Common variable immunodeficiency -1.340 6.7e-03
ependymoma -1.100 5.9e-05
gastric carcinoma 1.100 2.9e-02
group 4 medulloblastoma -1.200 6.1e-04
interstitial cystitis 1.200 1.7e-03
lung cancer -1.500 1.2e-02
non-inflammatory breast cancer -1.200 3.0e-02
ovarian cancer 1.300 2.7e-03
pituitary cancer 1.100 2.5e-03
primary pancreatic ductal adenocarcinoma 1.205 2.0e-02
primitive neuroectodermal tumor -1.400 2.7e-03
sarcoidosis -1.200 1.8e-04

Gene RIF (7)

AA Sequence

MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQLSQDLGGG      1 - 70
TLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHTILSNTHRQASRVVLSFD     71 - 140
FPFYGHPLRQITIATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVYL    141 - 210
QGWEDKGSFTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPDVPESRRRSIFEY    211 - 280
HRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQE    281 - 350
AEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGT    351 - 420
PVHLGTIVGIVLAVLLVAAIILAGIYINGHPTSNAALFFIERRPHHWPAMKFRSHPDHSTYAEVEPSGHE    421 - 490
KEGFMEAEQC                                                                491 - 500
//

Text Mined References (18)

PMID Year Title