Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.51
PubTator Score 110.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
posterior fossa group A ependymoma 1.800 1.9e-08
group 3 medulloblastoma -2.300 9.2e-04
cystic fibrosis 1.500 1.2e-04
atypical teratoid / rhabdoid tumor -1.400 2.1e-02
medulloblastoma, large-cell -3.000 9.8e-05
primitive neuroectodermal tumor -1.200 4.4e-02
Duchenne muscular dystrophy 1.600 6.5e-06
autosomal dominant Emery-Dreifuss muscul... 1.306 1.2e-02
juvenile dermatomyositis 1.385 3.0e-09
non-small cell lung cancer -1.607 1.0e-16
intraductal papillary-mucinous adenoma (... -1.700 1.1e-03
intraductal papillary-mucinous carcinoma... -1.200 1.9e-02
lung cancer -2.500 2.2e-06
colon cancer -1.500 2.0e-04
breast carcinoma -1.700 5.2e-31
lung adenocarcinoma -1.400 8.6e-15
Breast cancer -2.300 4.7e-11
Pick disease 1.100 1.5e-02
ductal carcinoma in situ -1.600 4.8e-04
invasive ductal carcinoma -2.900 1.8e-04
ulcerative colitis -1.100 6.7e-06
ovarian cancer -4.200 8.3e-10
pituitary cancer -2.100 1.3e-03
Down syndrome 1.700 8.4e-03

Gene RIF (5)

PMID Text
23089641 biochemical and functional characterization of human phospholipid scramblase 4
21690087 Crystallographic analysis of mammalian importin alpha1 in complex with the hPLSCR4-NLS reveals this minimal NLS binds specifically and exclusively to the minor binding site of importin alpha
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19540310 Results show that binding affinities of the peptides are in the order hPLSCR1>hPLSCR3>hPLSCR2>hPLSCR4 for Ca2+ and in the order hPLSCR1>hPLSCR2>hPLSCR3>hPLSCR4 for Mg2+.
19333378 SLPI is a ligand for PLSCR1 and PLSCR4, which also interact directly with the CD4 receptor at the cell surface of T lymphocytes

AA Sequence

MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP      1 - 70
LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN     71 - 140
NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE    141 - 210
VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN    211 - 280
GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR                         281 - 329
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23089641 2012 Biochemical and functional characterization of human phospholipid scramblase 4 (hPLSCR4).
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21690087 2011 A minimal nuclear localization signal (NLS) in human phospholipid scramblase 4 that binds only the minor NLS-binding site of importin alpha1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19540310 2009 Calcium binding studies of peptides of human phospholipid scramblases 1 to 4 suggest that scramblases are new class of calcium binding proteins in the cell.
19333378 2009 The phospholipid scramblases 1 and 4 are cellular receptors for the secretory leukocyte protease inhibitor and interact with CD4 at the plasma membrane.
18256029 2008 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10930526 2000 Identification of three new members of the phospholipid scramblase gene family.