Property Summary

NCBI Gene PubMed Count 47
PubMed Score 77.65
PubTator Score 51.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.433 1.8e-02
active ulcerative colitis 1.499 7.1e-03
acute myeloid leukemia -2.500 3.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.411 2.4e-02
Breast cancer -1.700 1.4e-04
dermatomyositis 1.200 4.6e-02
Duchenne muscular dystrophy 1.398 4.8e-05
group 3 medulloblastoma -1.200 1.8e-02
invasive ductal carcinoma -1.300 8.3e-03
juvenile dermatomyositis 1.275 1.7e-07
osteosarcoma 2.786 4.4e-06
ovarian cancer -3.400 7.1e-07
pancreatic cancer 1.600 1.8e-04
primary pancreatic ductal adenocarcinoma 1.685 2.8e-03
spina bifida -2.236 4.4e-02

Gene RIF (36)

AA Sequence

MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDG      1 - 70
KISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALEND     71 - 140
PDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCH    141 - 210
VVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFH    211 - 280
LENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCR    281 - 350
QFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY    351 - 420
ADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGN    421 - 490
QTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLID    491 - 560
AIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV    561 - 630
//

Text Mined References (55)

PMID Year Title