Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.69
PubTator Score 6.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.6e-12
acute quadriplegic myopathy 1157 2.8e-06
ovarian cancer 8491 2.3e-04
Disease Target Count Z-score Confidence
Atherosclerosis 275 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.002 3.6e-12
acute quadriplegic myopathy 1.046 2.8e-06
ovarian cancer 2.000 2.3e-04

Gene RIF (4)

PMID Text
22174317 HIV-1 Rev interacting protein, pleiotropic regulator 1 (PLRG1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PLRG1 is increased by RRE
20467437 A central region in hnRNP-M is required for interaction with CDC5L/PLRG1.
14576297 the interaction between CDC5L and PLRG1 is essential for pre-mRNA splicing
9765207 Study includes the isolation of a cDNA encoding the human PRL1 homolog.

AA Sequence

MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGP      1 - 70
QNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANR     71 - 140
TAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCI    141 - 210
AVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKV    211 - 280
IRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSH    281 - 350
DTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLT    351 - 420
VNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTAEADKTIKVYR    421 - 490
EDDTATEETHPVSWKPEIIKRKRF                                                  491 - 514
//

Text Mined References (20)

PMID Year Title
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21757653 2011 Assessment of genetic determinants of the association of ?' fibrinogen in relation to cardiovascular disease.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20176811 2010 Molecular architecture of the human Prp19/CDC5L complex.
19838058 2009 The Pso4 complex splices into the DNA damage response.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576297 2003 Identification of peptide inhibitors of pre-mRNA splicing derived from the essential interaction domains of CDC5L and PLRG1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176931 2002 Large-scale proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11544257 2001 A direct interaction between the carboxyl-terminal region of CDC5L and the WD40 domain of PLRG1 is essential for pre-mRNA splicing.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
9765207 1998 Pleiotropic control of glucose and hormone responses by PRL1, a nuclear WD protein, in Arabidopsis.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.