Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.14
PubTator Score 4.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 4.8e-03
atypical teratoid / rhabdoid tumor -3.300 8.8e-04
ependymoma -2.400 3.9e-02
glioblastoma -1.400 3.1e-02
group 4 medulloblastoma 2.000 7.0e-03
interstitial cystitis -1.600 1.1e-03
medulloblastoma, large-cell 2.200 3.5e-03
non primary Sjogren syndrome sicca -1.300 2.0e-02
oligodendroglioma -1.400 1.1e-02
pediatric high grade glioma -1.800 2.8e-02
psoriasis -2.000 1.9e-17

Gene RIF (2)

AA Sequence

MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYS      1 - 70
LAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAG     71 - 140
QVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAAMYLTMYI    141 - 210
TNTIKAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAE    211 - 280
NEHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT                                 281 - 321
//

Text Mined References (12)

PMID Year Title