Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.39
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 3.000 7.9e-10
atypical teratoid/rhabdoid tumor -1.200 1.7e-02
Breast cancer 1.600 8.4e-07
breast carcinoma 1.300 2.1e-28
cystic fibrosis 3.164 1.0e-07
ductal carcinoma in situ 2.300 1.1e-02
invasive ductal carcinoma 2.748 1.2e-05
non-small cell lung cancer 1.676 6.8e-14
ovarian cancer 1.800 4.4e-02
pancreatic cancer 1.900 4.0e-05
primary pancreatic ductal adenocarcinoma 1.533 5.8e-04
sonic hedgehog group medulloblastoma -1.500 3.0e-03

Synonym

Accession Q5VZY2 A2RU82 Q08EQ2 Q0IIP2 Q495B4 Q5VZY1
Symbols DPPL2
PPAPDC1
PPAPDC1A

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFLTPLAVICVVK      1 - 70
IIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRK     71 - 140
SFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVG    141 - 210
GVIGLIFAYICYRQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV             211 - 271
//

Text Mined References (7)

PMID Year Title