Property Summary

NCBI Gene PubMed Count 32
PubMed Score 61.02
PubTator Score 34.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (34)

Disease log2 FC p
nephrosclerosis 1.296 6.6e-05
malignant mesothelioma -1.400 3.8e-07
astrocytoma 1.800 3.1e-02
permanent atrial fibrillation -1.100 7.6e-04
psoriasis 2.700 4.3e-05
osteosarcoma 2.992 1.3e-03
group 4 medulloblastoma -4.000 1.1e-09
atypical teratoid / rhabdoid tumor -1.600 1.0e-03
glioblastoma 1.300 5.0e-03
medulloblastoma, large-cell -3.200 8.1e-06
autosomal dominant Emery-Dreifuss muscul... 1.145 1.5e-02
acute quadriplegic myopathy 1.434 1.4e-04
Atopic dermatitis -1.800 3.9e-04
adrenocortical carcinoma -1.442 1.0e-03
tuberculosis -3.100 3.5e-08
pancreatic ductal adenocarcinoma liver m... -1.804 9.5e-04
non-small cell lung cancer -1.269 1.4e-18
intraductal papillary-mucinous adenoma (... -2.600 1.4e-04
intraductal papillary-mucinous carcinoma... -2.600 1.8e-04
intraductal papillary-mucinous neoplasm ... -2.000 1.4e-02
colon cancer -2.800 7.7e-03
lung cancer -3.100 8.9e-06
breast carcinoma -1.800 8.1e-06
pilocytic astrocytoma 1.300 6.6e-04
posterior fossa group B ependymoma -1.100 5.8e-03
lung adenocarcinoma -2.000 6.3e-17
Breast cancer -1.400 1.0e-02
invasive ductal carcinoma -2.200 1.2e-03
Pick disease 1.300 6.3e-03
mucosa-associated lymphoid tissue lympho... 2.083 3.4e-02
ductal carcinoma in situ -1.700 5.8e-04
ovarian cancer 1.800 1.8e-03
Down syndrome 1.700 1.2e-02
pancreatic cancer 1.200 3.3e-02

 CSPA Cell Line (1)

Gene RIF (11)

PMID Text
26034042 Mechanosensitive PPAP2B plays a critical role in promoting anti-inflammatory phenotype and maintaining vascular integrity of endothelial monolayer under atheroprotective flow.
24518713 study concludes polymorphisms of TGM5, PPAP2B and PSMA4 are not major contributors tonon-small cell lung cancer susceptibility in never-smoking hinese population, this primarily can be attributed to the significantly distinct genetic background of Asian populations from western populations
23508853 PPAP2B gene rearrangement is associated with lipomas.
21569306 expression of LPP3 in human colon tumor (SW480) cells potentiated tumor growth via increased beta-catenin stability and CYCLIN-D1 synthesis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20123964 Results identify a key role for LPP3 in orchestrating PTEN-mediated beta-catenin/LEF-1 signaling in EC migration, cell-cell adhesion, and formation of branching point structures.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18215144 endogenous LPP2 and LPP3 form homo- and hetero-oligomers, which differ in their subcellular localization and which may confer differing spatial regulation of phosphatidic acid and sphingosine 1-phosphate signalling
17555747 LPP3 acted as an ecto-phosphatase on FTY720-P.
17005594 LPP1 and LPP3 are distributed in distinct lipid rafts that may provide unique microenvironments defining their non-redundant physiological functions.
12856002 there are marked differences in biochemical activity between fly Wun and mammalian lipid phosphate phosphatase (LPPs), with Wun having a narrower activity range than has been reported for the mammalian LPPs

AA Sequence

MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND      1 - 70
ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS     71 - 140
QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL    141 - 210
VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT    211 - 280
KTTLSLPAPAIRKEILSPVDIIDRNNHHNMM                                           281 - 311
//

Text Mined References (36)

PMID Year Title
26034042 2015 Mechanosensitive PPAP2B Regulates Endothelial Responses to Atherorelevant Hemodynamic Forces.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24518713 Association between TGM5, PPAP2B and PSMA4 polymorphisms and NSCLC in never-smoking Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23508853 2013 Identification of PPAP2B as a novel recurrent translocation partner gene of HMGA2 in lipomas.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21846871 2011 A genome-wide association study in europeans and South asians identifies 5 new Loci for coronary artery disease.
21569306 2011 Lipid phosphate phosphatase-3 regulates tumor growth via ?-catenin and CYCLIN-D1 signaling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20123964 2010 Lipid phosphate phosphatase 3 stabilization of beta-catenin induces endothelial cell migration and formation of branching point structures.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18215144 2008 Lipid phosphate phosphatases form homo- and hetero-oligomers: catalytic competency, subcellular distribution and function.
17555747 2007 FTY720-phosphate is dephosphorylated by lipid phosphate phosphatase 3.
17005594 2006 Lipid phosphate phosphatases 1 and 3 are localized in distinct lipid rafts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14725715 2004 Lipid phosphate phosphatases dimerise, but this interaction is not required for in vivo activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12856002 2003 Fly and mammalian lipid phosphate phosphatase isoforms differ in activity both in vitro and in vivo.
12660161 2003 Regulation of cell-cell interactions by phosphatidic acid phosphatase 2b/VCIP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471011 2003 Pulmonary phosphatidic acid phosphatase and lipid phosphate phosphohydrolase.
10739957 2000 Cell surface activities of the human type 2b phosphatidic acid phosphatase.
10564277 1999 Sequential actions of phospholipase D and phosphatidic acid phosphohydrolase 2b generate diglyceride in mammalian cells.
9705349 1998 Human type 2 phosphatidic acid phosphohydrolases. Substrate specificity of the type 2a, 2b, and 2c enzymes and cell surface activity of the 2a isoform.
9305923 1997 Cloning and characterization of two human isozymes of Mg2+-independent phosphatidic acid phosphatase.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.