Property Summary

NCBI Gene PubMed Count 11
PubMed Score 20.82
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.800 4.7e-07
esophageal adenocarcinoma 1.100 3.9e-02
cutaneous lupus erythematosus -1.400 5.3e-03
psoriasis 1.200 3.3e-04
sonic hedgehog group medulloblastoma -1.500 3.3e-03
medulloblastoma, large-cell -1.100 1.9e-02
non-small cell lung cancer 2.670 1.1e-25
interstitial cystitis -2.300 1.5e-04
lung adenocarcinoma 2.476 2.1e-10
subependymal giant cell astrocytoma -1.982 6.3e-03
ductal carcinoma in situ 2.000 1.2e-02
invasive ductal carcinoma 2.600 1.1e-02
pituitary cancer -1.400 3.7e-04
Down syndrome 1.300 1.6e-03

 MGI Phenotype (1)

Gene RIF (3)

PMID Text
18215144 endogenous LPP2 and LPP3 form homo- and hetero-oligomers, which differ in their subcellular localization and which may confer differing spatial regulation of phosphatidic acid and sphingosine 1-phosphate signalling
16467304 identified a novel and specific role for LPP2 activity and bioactive lipids in regulating cell cycle progression
10992322 Functional study of the mouse homolog

AA Sequence

MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVS      1 - 70
AGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNC     71 - 140
SVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYV    141 - 210
GYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNH    211 - 280
YGYPHSSS                                                                  281 - 288
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18215144 2008 Lipid phosphate phosphatases form homo- and hetero-oligomers: catalytic competency, subcellular distribution and function.
16467304 2006 Lipid phosphate phosphatase-2 activity regulates S-phase entry of the cell cycle in Rat2 fibroblasts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471011 2003 Pulmonary phosphatidic acid phosphatase and lipid phosphate phosphohydrolase.
10992322 2000 Mice mutant for Ppap2c, a homolog of the germ cell migration regulator wunen, are viable and fertile.
9705349 1998 Human type 2 phosphatidic acid phosphohydrolases. Substrate specificity of the type 2a, 2b, and 2c enzymes and cell surface activity of the 2a isoform.
9607309 1998 Identification of a novel human phosphatidic acid phosphatase type 2 isoform.
9570154 1998 Molecular cloning of two alternatively spliced forms of human phosphatidic acid phosphatase cDNAs that are differentially expressed in normal and tumor cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.