Property Summary

NCBI Gene PubMed Count 26
PubMed Score 27.90
PubTator Score 43.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 8.8e-04
Astrocytoma, Pilocytic 1.400 1.4e-06
Barrett's esophagus 1.100 3.3e-02
esophageal adenocarcinoma 1.800 1.8e-02
glioblastoma 1.500 1.7e-08
ovarian cancer 2.000 4.1e-07
psoriasis 2.000 3.1e-05
tuberculosis 1.200 1.4e-07

Gene RIF (11)

AA Sequence

MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLG      1 - 70
LGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSA     71 - 140
ESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSL    141 - 210
NLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCG    211 - 280
FCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQL    281 - 350
QDHFSAVKLVGPEEALSPGEARDMAMDLCRQDPECEFYFSLDADAVLTNLQTLRILIEENRKVIAPMLSR    351 - 420
HGKLWSNFWGALSPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGDTLRMELPQRDVFSGSDTDPD    421 - 490
MAFCKSFRDKGIFLHLSNQHEFGRLLATSRYDTEHLHPDLWQIFDNPVDWKEQYIHENYSRALEGEGIVE    491 - 560
QPCPDVYWFPLLSEQMCDELVAEMEHYGQWSGGRHEDSRLAGGYENVPTVDIHMKQVGYEDQWLQLLRTY    561 - 630
VGPMTESLFPGYHTKARAVMNFVVRYRPDEQPSLRPHHDSSTFTLNVALNHKGLDYEGGGCRFLRYDCVI    631 - 700
SSPRKGWALLHPGRLTHYHEGLPTTWGTRYIMVSFVDP                                    701 - 738
//

Text Mined References (29)

PMID Year Title