Property Summary

NCBI Gene PubMed Count 130
PubMed Score 84.75
PubTator Score 61.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis -2.000 5.0e-05
posterior fossa group B ependymoma 4.000 6.5e-07
hereditary spastic paraplegia -1.150 5.9e-03
acute quadriplegic myopathy -2.229 2.2e-06
limb girdle muscular dystrophy 2A -1.145 6.2e-05
Becker muscular dystrophy -1.056 2.0e-02
Atopic dermatitis -2.200 5.6e-04
adrenocortical adenoma -1.258 2.7e-02
adrenocortical carcinoma -1.734 7.9e-05
non-small cell lung cancer -1.644 4.5e-08
intraductal papillary-mucinous adenoma (... -2.400 2.4e-04
intraductal papillary-mucinous carcinoma... -2.300 2.5e-03
intraductal papillary-mucinous neoplasm ... -2.000 1.6e-02
colon cancer -4.500 2.9e-05
fibroadenoma -1.300 3.2e-02
interstitial cystitis 2.600 4.6e-04
lung adenocarcinoma -1.600 1.4e-05
Breast cancer 1.700 4.3e-02
lung carcinoma -1.200 1.2e-05

Gene RIF (73)

PMID Text
26966065 These data suggest that PLN is, at least partially, oligo-ubiquitinated at Lys(3) and degraded through Ser(16)-phosphorylation-mediated poly-ubiquitination during heart failure.
26743715 Phospholamban and sarcolipin are membrane proteins that differentially regulate SERCA function. (Review)
26542032 PLN may be a key molecular player in rigid substrate-induced cellular hypertrophy in eosinophilic esophagitis.
25983321 Although SLN and PLB binding to SERCA have different functional outcomes on the coupling efficiency of SERCA, both proteins decrease the apparent Ca(2+) affinity of the pump, suggesting that SLN and PLB inhibit SERCA by using a similar mechanism.
25928149 PLN mutations rarely cause cardiomyopathy
25775607 analysis of how the conformational dynamics of protein kinase A induced by a lethal mutant of phospholamban hinder phosphorylation
25563649 hereditary mutants of phospholamban are associated with heart failure [review]
25562800 PLN pentamers reduce phosphorylation of monomers at baseline and delay monomer phosphorylation upon PKA stimulation leading to increased interaction of PLN monomers with SERCA2a.
25504561 Engineered upregulation of PLB expression in hESC/iPSC-vCMs restores a positive inotropic response to beta-adrenergic stimulation.
25451386 Phospholamban, and its interacting partners, regulates excitation contraction coupling and myocardial contraction. [Review]
25074938 We conclude that PLB C-terminal residues are critical for localization, oligomerization, and regulatory function. In particular, the PLB C terminus is an important determinant of the quaternary structure of the SERCA regulatory complex.
24909667 Phospholamban R14del mutation carriers are at high risk for malignant ventricular arrhythmias and end-stage heart failure, with left ventricular ejection fraction <45% and sustained or nonsustained ventricular tachycardia as independent risk factors.
24835503 a previously unrecognized mechanism for ESM cell contraction that depends on TGF-beta1, its receptors, and PLN.
24732829 Aim of the present study is to determine the exact pattern of fibrosis and fatty replacement in PLN p.Arg14del mutation positive patients.
24358354 SLN and PLN are co-expressed in most fibers, which suggests that super-inhibition of SERCAs may be physiologically important in the regulation of intracellular Ca2+ in human skeletal muscle.
24037902 Report PLN mutations in dilated cardiomyopathy.
23871674 PLN mutation carriers have ARVD/C characteristics, including important right ventricular involvement, and additionally more often low-voltage electrocardiograms, inverted T waves in the left precordial leads, and left ventricular involvement.
23349452 A PLN founder mutation and LMNA mutations were most prevalent and often demonstrated a specific phenotype in dilated cardiomyopathy patients
23308118 In the context of data on PLN/SERCA interaction and on Ca(2+) accumulation in the sarcoplasmic reticulum the present results are consistent with the view that PLN channel activity could participate in the balancing of charge during Ca(2+) uptake.
22820313 The researchers found evidence of an association between the phospholamban R14del and the presence of dilated or arrhythmogenic cardiomyopathies in a group of patients.
22427649 Hydrophobic imbalance in the cytoplasmic domain of phospholamban is a determinant for lethal dilated cardiomyopathy.
22247554 Characterizing phospholamban to sarco(endo)plasmic reticulum Ca2+-ATPase 2a (SERCA2a) protein binding interactions in human cardiac sarcoplasmic reticulum vesicles using chemical cross-linking.
22172806 TOAC spin labels placed on the WT-PLB transmembrane domain showed highly restricted motion with more than 100ns rotational correlation time (tau(c)); whereas the loop, and the cytoplasmic regions each consists of two distinct motional dynamics
22155237 human PLN-R14Del is misrouted to the sarcolemma, in the absence of endogenous PLN, and alters NKA activity, leading to cardiac remodeling.
22137083 1,014 patients with heart failure screened for mutations in PLN gene; identified 4 unrelated patients with PLN mutations, 3 in same amino acid residue (R9); conclude mutations in PLN gene are rare cause of heart failure, present almost exclusively in patients with dilated cardiomyopathy etiology; Arg9 and Leu39 residues are leading location of mutations described to date
21687864 PLN generates canonical ion channel fluctuations with two conductance levels and a moderate cation selectivity
21576492 both topology and function of PLN are shaped by the interactions with lipids, which fine-tune the regulation of SERCA
21332051 PLN gene mutations were not found to be associated with HCM in the study group.
21282613 Lethal Arg9Cys phospholamban mutation hinders Ca2+-ATPase regulation and phosphorylation by protein kinase A.
21167350 Mutations in PLN are rare in frequency, yet the small size of the genetic locus may make it amenable to inclusion on HCM gene test panels.
21108950 In this study, they investigated the effects of PLB phosphorylation and mutation on the interaction between a PLB oligomer and SERCA in the context of 2D crystals.
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20634894 Study conclude that PLN is enriched in the ER due to COP I-mediated transport that is dependent on its intact di-arginine motif and that the N-terminal di-arginine motif may act as a general ER retrieval sequence.
20474083 Observational study of genetic testing. (HuGE Navigator)
19875404 Observational study of gene-disease association. (HuGE Navigator)
19708671 Three steps in the kinetic reaction with calcium-dependent ATPase (SERCA) are affected by the presence of PLB: binding of the first calcium ion, a subsequent conformational change in SERCA, and binding of the second calcium ion.
19671701 These data demonstrate that alphaKAP exhibits a novel interaction with SERCA2a and may serve to spatially position CaMKII isoforms at the SR and to uniquely modulate the phosphorylation of PLN.
19638213 Data do not support a role for the phospholamban -36A>C alteration in modulating the heart failure phenotype.
19638213 Observational study of gene-disease association. (HuGE Navigator)
19587794 PLN is a key regulator of cardiac diastolic function and is involved in regulating intracellular calcium cycling, it has only recently been identified as a susceptibility locus for QT interval
19587794 Meta-analysis and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19324307 Attenuated R amplitudes were identified as an early ECG phenotype in a family with familial dilated cardiomyopathy due to the PLN-R14Del mutation.
19305409 Genome-wide association study of gene-disease association. (HuGE Navigator)
19305408 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19139388 A weak inhibitor transgene PLN(Arg9Cys) is diminished in its ability to modify the level of sarco(endo)plasmic reticulum ccalcium-ATPase activity, leading to heart failure despite fast sarcoplasmic reticulum calcium ion reuptake.
18708665 analysis of how mutations increase phospholamban oligomerization and alter the structure of its regulatory complex
18241046 findings suggest that the g.203A>C genetic variant in the human phospholamban promoter may contribute to depressed contractility and accelerate functional deterioration in heart failure
18241046 Observational study of gene-disease association. (HuGE Navigator)
18192322 G147D PPI-1 can attenuate responses of cardiomyocytes to beta-adrenergic agonists by decreasing PLN phosphorylation and therefore may contribute to deteriorated function in heart failure.
17905829 analysis of phospholamban in oriented lipid bilayers using 15N solid-state NMR spectroscopy
17766390 The structure and dynamics of PLN pentamer was compared in its unphosphorylated and pseudo-phosphorylatd states.
17655857 A truncation mutant was identified in PLN.
17515962 Gene expression of PLB was studied in children with congenital heart defects.
17010801 Observational study of gene-disease association. (HuGE Navigator)
17009399 Phospholamban in the human esophagus might be of less importance for regulation of SERCA than in heart. Lower expression of calsequestrin and calreticulin might contribute to increased lower esophageal sphincter pressure in achalasia.
16829191 Mutations in the phospholamban gene are not a frequent cause of hypertrophic and idiopathic dilated cardiomyopathy.
16476846 Human PLN may play a more inhibitory role than that of other species in Ca2+ cycling. Expression of human PLN in the mouse is compensated by alterations in Ca2+-handling proteins and cardiac remodeling in an effort to normalize cardiac contractility.
16432188 the nonreversible superinhibitory function of mutant PLN-R14Del may lead to inherited dilated cardiomyopathy and premature death in both humans and mice
16382369 Observational study of gene-disease association. (HuGE Navigator)
16235537 Observational study of gene-disease association. (HuGE Navigator)
16043693 The unusual bellflower-like assembly is held together by leucine/isoleucine zipper motifs along the membrane-spanning helices.
15736939 This study concludes that phospholamban (PLB) increases the maximal activity (Vmax) of calcium (Ca2+)-ATPase, and that the magnitude of this effect is sensitive to mutation. A region of mutant PLB responsible for this regulatory property is identified.
15640069 Observational study of gene-disease association. (HuGE Navigator)
14530977 The frequency-dependent phosphorylation of Ser16-PLB may favor an increase in Ca2+ transient and force generation in humans.
12804600 SERCA2a and phospholamban bind to S100A1 in the human heart
12705874 Observational study of gene-disease association. (HuGE Navigator)
12705874 Mutation of the phospholamban promoter associated with hypertrophic cardiomyopathy.
12692302 role in regulating sarco(endo)plasmic reticulum Ca2+-ATPase by binding to transmembrane helices in conjunction with sarcolipin
12610310 report that an inherited human dilated cardiomyopathy with refractory congestive heart failure is caused by a dominant Arg --> Cys missense mutation at residue 9 (R9C) in phospholamban
12525698 Modeling of the inhibitory interaction of phospholamban with the Ca2+ ATPase.
12080135 phosphorylation of phospholamban does not affect its structure and gives it more loose helical packing than if not phosphorylated
12032137 sarcolipin binds to phospholamban and inhibits polymerization

AA Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL                        1 - 52
//

Text Mined References (133)

PMID Year Title
26970417 2016 Phospholamban p.Arg14del cardiomyopathy is characterized by phospholamban aggregates, aggresomes, and autophagic degradation.
26966065 2016 Phospholamban degradation is induced by phosphorylation-mediated ubiquitination and inhibited by interaction with cardiac type Sarco(endo)plasmic reticulum Ca(2+)-ATPase.
26917049 2016 Mutation analysis of the phospholamban gene in 315 South Africans with dilated, hypertrophic, peripartum and arrhythmogenic right ventricular cardiomyopathies.
26885692 2016 Cervical cancer systemic inflammation score: a novel predictor of prognosis.
26816378 2016 A peptide encoded by a transcript annotated as long noncoding RNA enhances SERCA activity in muscle.
26800703 2016 Sudden Cardiac Arrest and Rare Genetic Variants in the Community.
26791827 2016 Intensive training and reduced volume increases muscle FXYD1 expression and phosphorylation at rest and during exercise in athletes.
26743715 2016 Phospholamban and sarcolipin: Are they functionally redundant or distinct regulators of the Sarco(Endo)Plasmic Reticulum Calcium ATPase?
26673394 2016 Phospholamban spontaneously reconstitutes into giant unilamellar vesicles where it generates a cation selective channel.
26643481 2016 Search for Rare Copy-Number Variants in Congenital Heart Defects Identifies Novel Candidate Genes and a Potential Role for FOXC1 in Patients With Coarctation of the Aorta.
26542032 2016 Rigid substrate induces esophageal smooth muscle hypertrophy and eosinophilic esophagitis fibrotic gene expression.
26535225 2015 Genetic modifiers to the PLN L39X mutation in a patient with DCM and sustained ventricular tachycardia?
26292938 2015 Rheostatic Regulation of the SERCA/Phospholamban Membrane Protein Complex Using Non-Coding RNA and Single-Stranded DNA oligonucleotides.
26075818 2015 PHD2/3-dependent hydroxylation tunes cardiac response to ?-adrenergic stress via phospholamban.
26040000 2015 Metformin increases degradation of phospholamban via autophagy in cardiomyocytes.
26027516 2015 Phosphorylation state-dependent interaction between AKAP7?/? and phospholamban increases phospholamban phosphorylation.
26014576 2015 Linking superinhibitory PLN mutations to CaMKII activation: a new arrhythmogenic mechanism in genetic DCM?
26005176 2015 Chamber-specific changes in calcium-handling proteins in the type 2 diabetic human heart with preserved ejection fraction.
25983321 2015 Sarcolipin and phospholamban inhibit the calcium pump by populating a similar metal ion-free intermediate state.
25928149 2015 A study in Polish patients with cardiomyopathy emphasizes pathogenicity of phospholamban (PLN) mutations at amino acid position 9 and low penetrance of heterozygous null PLN mutations.
25923014 2015 Correction of human phospholamban R14del mutation associated with cardiomyopathy using targeted nucleases and combination therapy.
25882845 2015 The N Terminus of Sarcolipin Plays an Important Role in Uncoupling Sarco-endoplasmic Reticulum Ca2+-ATPase (SERCA) ATP Hydrolysis from Ca2+ Transport.
25852082 2015 A novel human R25C-phospholamban mutation is associated with super-inhibition of calcium cycling and ventricular arrhythmia.
25775607 2015 Dysfunctional conformational dynamics of protein kinase A induced by a lethal mutant of phospholamban hinder phosphorylation.
25730320 2015 The regulation of sarco(endo)plasmic reticulum calcium-ATPases (SERCA).
25691538 2015 Role of common and rare variants in SCN10A: results from the Brugada syndrome QRS locus gene discovery collaborative study.
25676813 2015 The ARVD/C genetic variants database: 2014 update.
25637602 2015 Therapeutic Molecular Phenotype of ?-Blocker-Associated Reverse-Remodeling in Nonischemic Dilated Cardiomyopathy.
25593317 2015 Acute inotropic and lusitropic effects of cardiomyopathic R9C mutation of phospholamban.
25563649 2015 Deception in simplicity: hereditary phospholamban mutations in dilated cardiomyopathy.
25562800 2015 Phospholamban pentamers attenuate PKA-dependent phosphorylation of monomers.
25504561 2015 Phospholamban as a crucial determinant of the inotropic response of human pluripotent stem cell-derived ventricular cardiomyocytes and engineered 3-dimensional tissue constructs.
25461674 2015 Nitric oxide enhances extracellular ATP induced Ca²? oscillation in HeLa cells.
25451386 2014 Phospholamban interactome in cardiac contractility and survival: A new vision of an old friend.
25416956 2014 A proteome-scale map of the human interactome network.
25251363 2015 Effects of naturally occurring arginine 14 deletion on phospholamban conformational dynamics and membrane interactions.
25225809 2014 Comparison of the structure and function of phospholamban and the arginine-14 deficient mutant associated with dilated cardiomyopathy.
25208486 2014 Integrin-linked kinase mediates force transduction in cardiomyocytes by modulating SERCA2a/PLN function.
25194792 2014 Competitive displacement of wild-type phospholamban from the Ca2+-free cardiac calcium pump by phospholamban mutants with different binding affinities.
25121716 2014 Binding of a monoclonal antibody to the phospholamban cytoplasmic domain interferes with the channel activity of phospholamban reconstituted in a tethered bilayer lipid membrane.
25074938 2014 Phospholamban C-terminal residues are critical determinants of the structure and function of the calcium ATPase regulatory complex.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24909667 2014 Outcome in phospholamban R14del carriers: results of a large multicentre cohort study.
24895160 2014 Protein changes contributing to right ventricular cardiomyocyte diastolic dysfunction in pulmonary arterial hypertension.
24835503 2014 TGF-?1-induced phospholamban expression alters esophageal smooth muscle cell contraction in patients with eosinophilic esophagitis.
24756636 2014 Molecular mechanisms of neuronal nitric oxide synthase in cardiac function and pathophysiology.
24732829 2014 High resolution systematic digital histological quantification of cardiac fibrosis and adipose tissue in phospholamban p.Arg14del mutation associated cardiomyopathy.
24358354 2013 Co-expression of SERCA isoforms, phospholamban and sarcolipin in human skeletal muscle fibers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24037902 2013 The genetics of dilated cardiomyopathy: a prioritized candidate gene study of LMNA, TNNT2, TCAP, and PLN.
23871674 2013 Arrhythmogenic right ventricular dysplasia/cardiomyopathy according to revised 2010 task force criteria with inclusion of non-desmosomal phospholamban mutation carriers.
23349452 2013 Genetic analysis in 418 index patients with idiopathic dilated cardiomyopathy: overview of 10 years' experience.
23308118 2013 Structure-function relation of phospholamban: modulation of channel activity as a potential regulator of SERCA activity.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22820313 2012 Phospholamban R14del mutation in patients diagnosed with dilated cardiomyopathy or arrhythmogenic right ventricular cardiomyopathy: evidence supporting the concept of arrhythmogenic cardiomyopathy.
22707725 2012 Lethal, hereditary mutants of phospholamban elude phosphorylation by protein kinase A.
22679139 2012 Modulation of cardiac contractility by the phospholamban/SERCA2a regulatome.
22427649 2012 Hydrophobic imbalance in the cytoplasmic domain of phospholamban is a determinant for lethal dilated cardiomyopathy.
22247554 2012 Characterizing phospholamban to sarco(endo)plasmic reticulum Ca2+-ATPase 2a (SERCA2a) protein binding interactions in human cardiac sarcoplasmic reticulum vesicles using chemical cross-linking.
22172806 2012 Probing the helical tilt and dynamic properties of membrane-bound phospholamban in magnetically aligned bicelles using electron paramagnetic resonance spectroscopy.
22155237 2012 The human phospholamban Arg14-deletion mutant localizes to plasma membrane and interacts with the Na/K-ATPase.
22137083 2011 Mutations in the human phospholamban gene in patients with heart failure.
21687864 2011 Phospholamban generates cation selective ion channels.
21576492 2011 Structural topology of phospholamban pentamer in lipid bilayers by a hybrid solution and solid-state NMR method.
21332051 2011 Phospholamban gene mutations are not associated with hypertrophic cardiomyopathy in patients from southern Poland.
21282613 2011 Lethal Arg9Cys phospholamban mutation hinders Ca2+-ATPase regulation and phosphorylation by protein kinase A.
21167350 2011 PLN-encoded phospholamban mutation in a large cohort of hypertrophic cardiomyopathy cases: summary of the literature and implications for genetic testing.
21108950 2011 Phosphorylation and mutation of phospholamban alter physical interactions with the sarcoplasmic reticulum calcium pump.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20634894 2010 Endoplasmic reticulum protein targeting of phospholamban: a common role for an N-terminal di-arginine motif in ER retention?
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
19875404 2009 The role of Lamin A/C mutations in Danish patients with idiopathic dilated cardiomyopathy.
19708671 2009 Effects of phospholamban transmembrane mutants on the calcium affinity, maximal activity, and cooperativity of the sarcoplasmic reticulum calcium pump.
19671701 2009 Alpha-kinase anchoring protein alphaKAP interacts with SERCA2A to spatially position Ca2+/calmodulin-dependent protein kinase II and modulate phospholamban phosphorylation.
19638213 2009 No evidence for an association between the -36A>C phospholamban gene polymorphism and a worse prognosis in heart failure.
19587794 2009 Common genetic variation near the phospholamban gene is associated with cardiac repolarisation: meta-analysis of three genome-wide association studies.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19324307 2009 Genetic deletion of arginine 14 in phospholamban causes dilated cardiomyopathy with attenuated electrocardiographic R amplitudes.
19305409 2009 Common variants at ten loci modulate the QT interval duration in the QTSCD Study.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
19139388 2009 Alterations of phospholamban function can exhibit cardiotoxic effects independent of excessive sarcoplasmic reticulum Ca2+-ATPase inhibition.
18708665 2008 Phosphomimetic mutations increase phospholamban oligomerization and alter the structure of its regulatory complex.
18241046 2008 A human phospholamban promoter polymorphism in dilated cardiomyopathy alters transcriptional regulation by glucocorticoids.
18192322 2008 A human polymorphism of protein phosphatase-1 inhibitor-1 is associated with attenuated contractile response of cardiomyocytes to beta-adrenergic stimulation.
17905829 2007 The structural topology of wild-type phospholamban in oriented lipid bilayers using 15N solid-state NMR spectroscopy.
17766390 2007 Comparing the structure and dynamics of phospholamban pentamer in its unphosphorylated and pseudo-phosphorylated states.
17655857 2007 Genetic screening of calcium regulation genes in familial hypertrophic cardiomyopathy.
17515962 SERCA2a, phospholamban, sarcolipin, and ryanodine receptors gene expression in children with congenital heart defects.
17241641 2007 Phospholamban interacts with HAX-1, a mitochondrial protein with anti-apoptotic function.
17010801 2006 Phospholamban R14 deletion results in late-onset, mild, hereditary dilated cardiomyopathy.
17009399 2006 Reduced expression of Ca2+-regulating proteins in the upper gastrointestinal tract of patients with achalasia.
16897780 2006 Structure determination of symmetric homo-oligomers by a complete search of symmetry configuration space, using NMR restraints and van der Waals packing.
16829191 2007 Mutational screening of phospholamban gene in hypertrophic and idiopathic dilated cardiomyopathy and functional study of the PLN -42 C>G mutation.
16690701 2006 Ca2+-calmodulin-dependent protein kinase expression and signalling in skeletal muscle during exercise.
16476846 2006 The presence of Lys27 instead of Asn27 in human phospholamban promotes sarcoplasmic reticulum Ca2+-ATPase superinhibition and cardiac remodeling.
16432188 2006 A mutation in the human phospholamban gene, deleting arginine 14, results in lethal, hereditary cardiomyopathy.
16382369 2005 Phospholamban gene mutations are not associated with hypertrophic cardiomyopathy in a Northern Greek population.
16235537 2005 [Association between phospholamban gene mutation and dilated cardiomyopathy in the Chengdu area].
16043693 2005 The structure of phospholamban pentamer reveals a channel-like architecture in membranes.
15736939 2005 The effects of mutation on the regulatory properties of phospholamban in co-reconstituted membranes.
15640069 2004 [Association between mutation of phospholamban gene and dilated cardiomyopathy].
15598648 2005 Myotonic dystrophy protein kinase phosphorylates phospholamban and regulates calcium uptake in cardiomyocyte sarcoplasmic reticulum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14530977 2003 Ser16-, but not Thr17-phosphorylation of phospholamban influences frequency-dependent force generation in human myocardium.
12804600 2003 Ca2+ -dependent interaction of S100A1 with the sarcoplasmic reticulum Ca2+ -ATPase2a and phospholamban in the human heart.
12705874 2003 Mutation of the phospholamban promoter associated with hypertrophic cardiomyopathy.
12692302 2003 Sarcolipin regulates sarco(endo)plasmic reticulum Ca2+-ATPase (SERCA) by binding to transmembrane helices alone or in association with phospholamban.
12639993 2003 Human phospholamban null results in lethal dilated cardiomyopathy revealing a critical difference between mouse and human.
12610310 2003 Dilated cardiomyopathy and heart failure caused by a mutation in phospholamban.
12525698 2003 Modeling of the inhibitory interaction of phospholamban with the Ca2+ ATPase.
12480535 2003 Association of phospholamban with a cGMP kinase signaling complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080135 2002 Structure of the 1-36 N-terminal fragment of human phospholamban phosphorylated at Ser-16 and Thr-17.
12032137 2002 Sarcolipin inhibits polymerization of phospholamban to induce superinhibition of sarco(endo)plasmic reticulum Ca2+-ATPases (SERCAs).
11854448 2002 Reconstitution of the cytoplasmic interaction between phospholamban and Ca(2+)-ATPase of cardiac sarcoplasmic reticulum.
11526231 2001 Phospholamban domain IB forms an interaction site with the loop between transmembrane helices M6 and M7 of sarco(endo)plasmic reticulum Ca2+ ATPases.
10809745 2000 Physical interactions between phospholamban and sarco(endo)plasmic reticulum Ca2+-ATPases are dissociated by elevated Ca2+, but not by phospholamban phosphorylation, vanadate, or thapsigargin, and are enhanced by ATP.
10551848 1999 Transmembrane helix M6 in sarco(endo)plasmic reticulum Ca(2+)-ATPase forms a functional interaction site with phospholamban. Evidence for physical interactions at other sites.
10198197 1999 The human phospholamban gene: structure and expression.
10096878 1999 Structure of the 1-36 amino-terminal fragment of human phospholamban by nuclear magnetic resonance and modeling of the phospholamban pentamer.
9845327 1998 Biophysical interaction between phospholamban and protein phosphatase 1 regulatory subunit GM.
9512019 1998 Using experimental information to produce a model of the transmembrane domain of the ion channel phospholamban.
9468536 1998 Transgenic approaches to define the functional role of dual site phospholamban phosphorylation.
9345259 1997 Phospholamban: a protein coming of age.
8862513 1996 Sarcoplasmic reticulum Ca2+ATPase and phospholamban mRNA and protein levels in end-stage heart failure due to ischemic or dilated cardiomyopathy.
8406504 1993 Chromosome mapping of five human cardiac and skeletal muscle sarcoplasmic reticulum protein genes.
7779806 1995 Solution structure of the cytoplasmic domain of phopholamban: phosphorylation leads to a local perturbation in secondary structure.
7749920 1995 Computational searching and mutagenesis suggest a structure for the pentameric transmembrane domain of phospholamban.
7586307 1995 Unchanged protein levels of SERCA II and phospholamban but reduced Ca2+ uptake and Ca(2+)-ATPase activity of cardiac sarcoplasmic reticulum from dilated cardiomyopathy patients compared with patients with nonfailing hearts.
3759968 1986 Sequence analysis of phospholamban. Identification of phosphorylation sites and two major structural domains.
1828805 1991 Structure of the rabbit phospholamban gene, cloning of the human cDNA, and assignment of the gene to human chromosome 6.