Property Summary

NCBI Gene PubMed Count 58
PubMed Score 250.35
PubTator Score 110.28

Knowledge Summary

Patent (17,691)

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis 1.508 1.7e-04
gastric cancer -2.200 4.3e-04
hepatocellular carcinoma -2.100 5.3e-06
pancreatic cancer -2.300 2.7e-04
astrocytic glioma -2.800 1.2e-03
ependymoma -1.800 3.5e-02
oligodendroglioma -2.500 2.7e-16
psoriasis 1.100 4.0e-04
glioblastoma -2.300 3.2e-03
osteosarcoma 1.187 3.9e-02
Duchenne muscular dystrophy 1.162 1.3e-07
adrenocortical carcinoma 1.053 1.9e-02
intraductal papillary-mucinous adenoma (... -1.600 8.3e-03
lung cancer -1.900 1.2e-03
ulcerative colitis 1.700 1.2e-05
fibroadenoma 1.300 4.9e-02
diabetes mellitus -1.400 1.2e-02
Breast cancer 2.900 2.6e-02
pediatric high grade glioma -1.600 1.7e-02
pilocytic astrocytoma -1.700 9.5e-03
pancreatic carcinoma -2.300 2.7e-04
severe Alzheimer's disease -1.679 3.7e-02
lung carcinoma -1.400 7.3e-06
spina bifida -2.058 4.2e-02
ductal carcinoma in situ 1.300 4.5e-02
ovarian cancer 3.200 1.1e-05

Gene RIF (42)

PMID Text
26719332 Data suggest wild-type SNCA (alpha-synuclein) binding to synaptosome membrane is not affected by phosphorylation by PLK2; A30P SNCA, a Parkinson disease mutation, binding is greatly increased; endocytosis of SNCA fibrils follows similar pattern.
26625870 our study demonstrates a novel mechanism of PLK2 in promoting tumor progression, whereby it directly binds to enriched TAp73, catalyzes Ser48 phosphorylation of TAp73, and inhibits TAp73 transcriptional activity
26004360 these findings reveal a conserved PLK2-RAP1 pathway that is crucial to regulate endothelial tip cell behavior in order to ensure proper vascular development and patterning in vertebrates.
25846005 Structural analysis of the polo-box domain of human PLK2 has been presented.
25590559 PLK2 indirectly activates ROCK2 via phosphorylating nucleophosmin during centrosome amplification.
25511705 this study reports the first crystal structure of the C-terminal polo-box domain of PLK2.
25501818 Silencing of polo-like kinase 2 increases cell proliferation and decreases apoptosis in SGC-7901 gastric cancer cells.
25347426 Decreased PLK2 protein expression due to promoter hypermethylation was negatively correlated with JAK2 overexpression, a common occurrence in hematological malignancies.
25338102 Unique PLK2-dependent protein phosphorylation sites identified by mass spectrometry.
25239093 Data shows that PLK2 mRNA is a direct target of miR-27a in laryngeal squamous cell carcinoma.
24969300 Study indicates that miR-126 is a tumor suppressor that inhibits gastric cancer cells proliferation by targeting PI3KR2, Crk and PLK2.
24887096 the regulation of redox homeostasis by PLK2 promotes the survival of cells with dysfunctional mitochondria
24384746 PLK2 SNPs were associated with Alzheimer disease and mild cognitive impairment. PLK2-rs15009 CC and GG genotypes and CC genotype at PLK2-rs702723 were protective for AD.
24338472 Our findings suggest a new role for PLK2 in the regulation of inflammatory diseases by modulating ADAM17 activity.
23703673 Polo-like kinase 2 is a mediator of hedgehog survival signaling in cholangiocarcinoma.
23677647 This study supports a role for PLK2 in the generation of aSyn inclusions by a mechanism that does not depend directly on serine 129 phosphorylation.
23466428 PLK2 inhibition is a tractable CNS pharmacological target that does not cause genotoxicity at doses and exposures that engage the target in the sensory retina.
22828320 have identified and validated as in vitro PLK2 and PLK3 substrates HSP90, GRP-94, beta-tubulin, calumenin, and 14-3-3 epsilon
22399798 Phosphorylation of Fbxw7 by Plk2 induces destabilization of the F-box protein resulting in accumulation of cyclin E and increased potential for centriole reproduction
22289679 The methylation status of the PLK2 CpG island predicts outcomes in patients treated with carboplatin and paclitaxel chemotherapy.
22248692 PLK2 and to a lesser extent PLK3 are superior over CK2, as catalysts of Ser-129 phosphorylation both in full length alpha-synuclein and in a peptide reproducing the C-terminal segment of the protein.
22138223 Acetylation of GATA-1 responsive elements in Polo-like kinase 2 plays a crucial role in Plk2 transcription and protein expression in MG-63 cells.
22134238 Mutant p53 oncogenic functions are sustained by Plk2 kinase through an autoregulatory feedback loop.
22100274 phosphorylation sites could play an important role in the rapid activation, expansion, and prolongation of Plk2 signaling
21402713 Results implicate Plk2 as a clinically important determinant of chemosensitivity.
21340720 Polo-like kinase 2 (SNK/PLK2) is a novel epigenetically regulated gene in acute myeloid leukemia and myelodysplastic syndromes.
21067440 Identification of Snk/Plk2 as a novel methylated gene in multiple myeloma.
20531387 Results identify centrosomal P4.1-associated protein (CPAP), a human homologue of SAS-4, as a substrate of PLK2 whose activity oscillates during the cell cycle.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20352051 NPM/B23 is a direct target of Plk2 in the regulation of centriole duplication and that phosphorylation on serine 4 can trigger this process
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20054236 Our results point to a novel Plk2-TSC1 interaction with effects on mTOR signaling during hypoxia, and tumor growth that may enable targeting Plk2 signaling in cancer therapy.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19706541 Data show that PLK2 as a kinase that phosphorylates Ser-137 of PLK1, which is sufficient to mediate this survival signal.
19506885 overexpression of PLK2 in bladder carcinomas, suggesting a possible role of PLK2 in the pathogenesis of bladder carcinomas
19004816 PLK2 directly phosphorylates alpha-synuclein at Ser-129 in an in vitro biochemical assay
19001868 Plk2 mediated centriole duplication is dependent on Plk4 function
17912033 increased cell death observed after aphidicolin treatment and release in Plk2-deficient cells may result from both higher levels of replication stress-induced DNA damage and a dysfunctional S-phase checkpoint
17706602 is a novel target of ERRgamma, and their interaction is crucial for cancer cell proliferation
17671831 Calcipotriol affects proliferation of keratinocytes by decreasing the expression of EGR1 and PLK2
16203730 hVPS18 may play an important role in regulation of SNK activity through its ubiquitin ligase
12897130 there is a mitotic checkpoint wherein p53-dependent activation of Snk/Plk2 prevents mitotic catastrophe following spindle damage

AA Sequence

MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHHHHSHSGPEIS      1 - 70
RIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHK     71 - 140
HVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGN    141 - 210
FFINEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPF    211 - 280
ETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHT    281 - 350
VPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL    351 - 420
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEAD    421 - 490
CIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATD    491 - 560
APEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHT    561 - 630
KIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN                   631 - 685
//

Text Mined References (63)

PMID Year Title
26719332 2016 Effects of Serine 129 Phosphorylation on ?-Synuclein Aggregation, Membrane Association, and Internalization.
26625870 2016 PLK2 phosphorylates and inhibits enriched TAp73 in human osteosarcoma cells.
26004360 2015 Polo-like kinase 2 regulates angiogenic sprouting and blood vessel development.
25846005 2015 Structural analysis of the polo-box domain of human Polo-like kinase 2.
25590559 2015 Functional relationship among PLK2, PLK4 and ROCK2 to induce centrosome amplification.
25511705 2015 Crystal structure of the polo-box domain of polo-like kinase 2.
25501818 2015 Silencing of polo-like kinase 2 increases cell proliferation and decreases apoptosis in SGC-7901 gastric cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25347426 2015 The deregulated promoter methylation of the Polo-like kinases as a potential biomarker in hematological malignancies.
25338102 2014 Identification of the PLK2-dependent phosphopeptidome by quantitative proteomics [corrected].
25239093 2014 MicroRNA-27a promotes proliferation and suppresses apoptosis by targeting PLK2 in laryngeal carcinoma.
24969300 2014 Mir-126 inhibits growth of SGC-7901 cells by synergistically targeting the oncogenes PI3KR2 and Crk, and the tumor suppressor PLK2.
24887096 2014 Polo-like kinase 2 activates an antioxidant pathway to promote the survival of cells with mitochondrial dysfunction.
24384746 Reelin signaling pathway genotypes and Alzheimer disease in a Spanish population.
24338472 2014 Polo-like kinase 2, a novel ADAM17 signaling component, regulates tumor necrosis factor ? ectodomain shedding.
23983262 2013 Polo-like kinase 2 regulates selective autophagic ?-synuclein clearance and suppresses its toxicity in vivo.
23703673 2013 Polo-like kinase 2 is a mediator of hedgehog survival signaling in cholangiocarcinoma.
23677647 2013 PLK2 modulates ?-synuclein aggregation in yeast and mammalian cells.
23466428 2013 Pharmacological inhibition of polo like kinase 2 (PLK2) does not cause chromosomal damage or result in the formation of micronuclei.
22828320 2012 Investigation on PLK2 and PLK3 substrate recognition.
22399798 2012 Plk2 regulates centriole duplication through phosphorylation-mediated degradation of Fbxw7 (human Cdc4).
22289679 2012 Polo Like Kinase 2 Tumour Suppressor and cancer biomarker: new perspectives on drug sensitivity/resistance in ovarian cancer.
22248692 2012 Superiority of PLK-2 as ?-synuclein phosphorylating agent relies on unique specificity determinants.
22138223 2012 Upregulation of Polo-like kinase 2 gene expression by GATA-1 acetylation in human osteosarcoma MG-63 cells.
22134238 2011 Mutant p53 oncogenic functions are sustained by Plk2 kinase through an autoregulatory feedback loop.
22100274 2012 Identification and functional characterization of polo-like kinase 2 autoregulatory sites.
21402713 2011 Polo-like kinase Plk2 is an epigenetic determinant of chemosensitivity and clinical outcomes in ovarian cancer.
21340720 2011 Polo-like kinase 2 (SNK/PLK2) is a novel epigenetically regulated gene in acute myeloid leukemia and myelodysplastic syndromes: genetic and epigenetic interactions.
21067440 2010 Study of specific genetic and epigenetic variables in multiple myeloma.
20671765 2010 Multifaceted polo-like kinases: drug targets and antitargets for cancer therapy.
20531387 2010 PLK2 phosphorylation is critical for CPAP function in procentriole formation during the centrosome cycle.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20352051 2010 Polo-like kinase 2-dependent phosphorylation of NPM/B23 on serine 4 triggers centriole duplication.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
20054236 2009 The p53 target Plk2 interacts with TSC proteins impacting mTOR signaling, tumor growth and chemosensitivity under hypoxic conditions.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19706541 2009 Polo-like kinases mediate cell survival in mitochondrial dysfunction.
19506885 2010 Identification of urine PLK2 as a marker of bladder tumors by proteomic analysis.
19004816 2009 Polo-like kinase 2 (PLK2) phosphorylates alpha-synuclein at serine 129 in central nervous system.
19001868 2008 Plk2 regulated centriole duplication is dependent on its localization to the centrioles and a functional polo-box domain.
18832181 2008 Distinct microRNA expression profiles in acute myeloid leukemia with common translocations.
17912033 2007 Replication stress, defective S-phase checkpoint and increased death in Plk2-deficient human cancer cells.
17706602 2007 Polo-like kinase 2 gene expression is regulated by the orphan nuclear receptor estrogen receptor-related receptor gamma (ERRgamma).
17671831 2008 Calcipotriol affects keratinocyte proliferation by decreasing expression of early growth response-1 and polo-like kinase-2.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16203730 2005 Ubiquitylation and degradation of serum-inducible kinase by hVPS18, a RING-H2 type ubiquitin ligase.
16160013 2006 Transcriptional silencing of Polo-like kinase 2 (SNK/PLK2) is a frequent event in B-cell malignancies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15242618 2004 Polo-like kinase-2 is required for centriole duplication in mammalian cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972611 2003 Role of Plk2 (Snk) in mouse development and cell proliferation.
12897130 2003 Silencing of the novel p53 target gene Snk/Plk2 leads to mitotic catastrophe in paclitaxel (taxol)-exposed cells.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12651910 2003 The serum-inducible protein kinase Snk is a G1 phase polo-like kinase that is inhibited by the calcium- and integrin-binding protein CIB.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11716500 2001 Radiation-inducible hSNK gene is transcriptionally regulated by p53 binding homology element in human thyroid cells.
11696980 2001 Identification of the human homologue of the early-growth response gene Snk, encoding a serum-inducible kinase.
11039900 2000 Adhesion induced expression of the serine/threonine kinase Fnk in human macrophages.
10557092 1999 The physical association and phosphorylation of Cdc25C protein phosphatase by Prk.
10523297 1999 The polo-like protein kinases Fnk and Snk associate with a Ca(2+)- and integrin-binding protein and are regulated dynamically with synaptic plasticity.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.