Property Summary

NCBI Gene PubMed Count 482
PubMed Score 1176.34
PubTator Score 931.92

Knowledge Summary

Patent (74,781)

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.800 2.2e-07
osteosarcoma -1.120 4.2e-02
sonic hedgehog group medulloblastoma 1.300 9.3e-04
atypical teratoid / rhabdoid tumor 1.200 4.2e-06
glioblastoma 1.200 3.2e-03
medulloblastoma, large-cell 1.700 1.5e-05
non-small cell lung cancer 1.839 5.9e-26
breast carcinoma 1.400 1.2e-04
lung adenocarcinoma 1.200 3.2e-07
inflammatory breast cancer 3.000 1.2e-04
invasive ductal carcinoma 1.200 1.2e-04
psoriasis 1.900 6.1e-102

Protein-protein Interaction (183)

SFI1   PLK4   UBE2C   NDC80   AURKA   PPP1R12A   XPO1   ZW10   RAD21   PPP1R12B   DIAPH2   CLASP2   DCTN3   HAUS5   CEP152   CCNB2   SMC2   FGFR1OP   CDK1   TUBB   UBB   UBC   CCNB1   CDK2   WEE1   CDC25A   CDC25B   CDC25C   RPS27   KNTC1   NEK2   NUP98   ANAPC15   CDC42   HIST2H4A   RPS27A   UBA52   SKP1   TUBA4A   TUBB4B   KIF23   CDC20   CDC16   MAD2L1   ITGB3BP   DCTN1   PCM1   PDS5A   TCTN1   ERCC6L   C2CD3   LIN52   CDCA8   SGO2   ODF2   SGO1   TMEM67   CEP78   KIF24   CEP162   LIN9   CEP135   RPGRIP1L   HAUS3   NCAPH2   CENPP   TTBK2   LIN54   TCTN3   PMF1   BORA   CENPU   TUBA1A   CENPQ   TAOK1   CLASP1   HAUS6   WAPL   CNTRL   SDCCAG8   NCAPG2   CEP57   CEP97   CENPL   AHI1   CENPS   KIF2B   SPC24   KNL1   CEP70   NEDD1   CDC26   KIF18A   CEP76   ALMS1   NEK9   CEP192   FBF1   NUP133   SKA2   AHCTF1   SKA1   CENPT   HAUS1   OPTN   ANAPC16   SPDL1   SEH1L   CDCA5   AURKB   TCTN2   LIN37   CENPN   AJUBA   NSL1   CEP63   SCLT1   RAB3IP   CDK5RAP2   CEP89   PKMYT1   B9D2   GORASP1   CENPK   HAUS8   CENPO   CEP250   NUP85   HDAC8   CEP41   NUF2   NDEL1   MIS12   ANAPC1   CENPH   HAUS4   ZWILCH   SPC25   CENPJ   NEK6   INCENP   CENPM   PDS5B   SMC4   HAUS2   MKS1   NDE1   GTSE1   TMEM216   CEP72   RCC2   CC2D2A   CDC23   ANAPC7   ANAPC5   ANAPC4   ANAPC2   TPX2   FZR1   ANAPC10   B9D1   CEP131   CEP164   NUDC   NINL   CEP83   MAD1L1   PPP6R2   ARHGAP5   SPAG9   BICD2   STXBP4   ERCC4   TMF1   RAI14   MPRIP   TOPBP1   C1orf226   PRRC1   TBK1   MAVS   NOS1AP   SATB2  

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
619 screening 518 / 0 / 96591 Fluorescence polarization assay for PLK1 inhibitors
693 screening 127 / 0 / 96922 High throughput fluorescence polarization-based assay to screen for small molecule inhibitors of the Polo box domain (PBD) of Plk1.
744 screening 42 / 3 / 164 Fluorescence polarization assay for PLK1 confirmation assay
756 other 2 / 0 / 207 Fluorescence Polarization assay for Plk1: compound interference assay
785 confirmatory 39 / 1 / 0 Fluorescence Polarization assay for Plk1: IC50 Dose Response Assay
876 confirmatory 4 / 0 / 115 Concentration Response Redox Cycling H2O2 Generation assay to characterize small molecule inhibitors identified in the Polo box domain (PBD) of Plk1 Primary HTS.
877 confirmatory 15 / 0 / 102 Concentration Response fluorescence polarization-based assay to confirm small molecule inhibitors identified in the Polo box domain (PBD) of Plk1 Primary HTS.
936 confirmatory 2 / 0 / 117 Concentration Response Redox Cycling H2O2 Generation assay, 1 mM DTT, to characterize small molecule inhibitors identified in the Polo box domain (PBD) of Plk1 Primary HTS.
1053 screening 2 / 0 / 182 High throughput fluorescence polarization-based assay to screen for small molecule inhibitors of the Polo box domain (PBD) of Plk1 to follow up on purchased Analogs of Selected Hits from the screen.
1057 confirmatory 0 / 0 / 33 Concentration Response fluorescence polarization-based assay to test PMLSC Chemistry Core synthesized analogs of confirmed hits from the Polo box domain (PBD) of Plk1 Primary HTS.
More...

Gene RIF (431)

PMID Text
27102712 Augmented expression of Aurora kinase-A and Polo-like kinase-1 at the lactogenic switch likely mediates the formation of binucleated cells.
27002166 MLL5 preserves spindle bipolarity through maintaining cytosolic PLK1 in a nonaggregated form.
26919439 Mutation of the T-loop activating residue T210 and adjacent T214 are lethal, but individual mutation of the remaining 32 posttranslational modification sites did not disrupt the essential functions of Plk1.
26912231 Bub1-Plk1-mediated phosphorylation of Cdc20 constitutes an anaphase-promoting complex or cyclosome-inhibitory mechanism that is parallel, but not redundant, to mitotic checkpoint complex formation.
26794530 PLK1 is overexpressed in osteosarcoma and GSK461364 exerted its cytotoxic effect on osteosarcoma by inducing mitotic arrest and subsequent apoptosis and induced cellular senescence
26786872 Perturbations in PLK functions have disease implications, such as cancer in humans, and thus human PLK1 is targeted for cancer therapeutics
26647647 PCNT has to be phosphorylated by PLK1 to be a suitable substrate of separase.
26608325 The authers have identified the serine/threonine kinase Polo-like kinase 1 (PLK1) as a host kinase that phosphorylates mumps virus P and have found that phosphorylation of P by PLK1 is enhanced by mumps virus NP.
26595675 Suggest that the p53-p21-DREAM-CDE/CHR pathway regulates p53-dependent repression of Survivin, CDC25C, and PLK1 in HCT116 cells.
26576650 FOXM1 is overexpressed in a large proportion of gastric carcinomas at the protein level and FOXM1 and PLK1 are concomitantly overexpressed at the mRNA level in this cancer type
26557691 These domains regulate the catalytic activation and subcellular localization of PLK-1.
26549165 Study indicated that miR-296 regulated PLK1 expression and could function as a tumor suppressor in non-small cell lung cancer progression.
26513691 Selective blockade of cancer cell proliferation and anchorage-independent growth can be achieved via Plk1 activity-dependent suicidal inhibition of its polo-box domain.
26503893 PLK1 blockade enhanced the cytotoxic effects of radiation by modulating cell cycle phases of cancer cells
26493360 Data suggest that high-throughput screening and identify bifunctional polo like kinase (Plk1) inhibitors may contribute in selective targeting of Plk1 to elicit desired biological process.
26468278 FOXK1 protein levels and activity are regulated by associating with JLP and PLK1
26406118 The authors propose that Gravin-mediated recruitment of Aurora A and Plk1 to the mother (oldest) spindle pole contributes to the fidelity of symmetric cell division.
26401039 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that PLK1-Vpr interaction affects TNF production from HIV-1 infected cells
26323689 The spatial and temporal regulation of Plk1 is required for initial kinetochore-microtubule attachment, proper chromosome alignment, and timely chromatid segregation.
26318737 This study shows that PLK1 provide valuable prognostic information in patients with neuroblastomas.
26317649 Combined Plk1-HDAC inhibition reduces survival in Hela cells but not in non-cancer cells.
26293378 The role of Plk1 in the maturation and distancing of the daughter centriole in HeLa cells, allowing reduplication of the mother centriole even if the original daughter centriole is still orthogonal to it.
26291670 PLK1 binding to JIP4 was found in G2 phase and mitosis, and PLK1 binding was self-primed by PLK1 phosphorylation of JIP4.
26259146 RSF1 localizes at mitotic kinetochores and directly binds PLK1.
26242183 Knockdown of Plk1 attenuated the phosphorylation of MEK1/2 pathway as well as cell proliferation.
26206521 the Aurora B-PLK1 signaling at the kinetochore orchestrates MCAK activity, which is essential for timely correction of aberrant kinetochore attachment to ensure accurate chromosome segregation during mitosis.
26192437 LRRK1 regulates mitotic spindle orientation downstream of PLK1 through CDK5RAP2-dependent centrosome maturation.
26171916 Combined immunohistochemistry of PLK1, p21, and p53 can predict the TP53 status of breast cancer patients.
26124292 A major function of Mio in mitosis is to regulate the activation/deactivation of Plk1 and Aurora A.
26119734 Plk1 promotes checkpoint signaling at kinetochores through the phosphorylation of at least two Mps1 substrates, including KNL-1 and Mps1 itself.
26090465 our results indicated that mir3686 could target PLK1 to inhibit the cell proliferation in pancreas cancer derived cell line and mir3686 could be a new therapeutic target for pancreas cancer treatment.
26070557 Collectively, these observations suggested that Plk1 is a positive modulator of telomerase by enhancing the stability of hTERT.
26057687 PLK1-mediated phosphorylation protects the binding of Mob1 to NDR1 and subsequent NDR1 activation
26047016 Data suggest that low polo-like kinase 1 (PLK1) score was an independent predictor of superior overall survival.
26012549 Plk1 promotes centrosome-based bipolar spindle formation by forming two functionally nonredundant complexes with Cep192.
25975351 Suggest that polo-box domain of Plk1 plays a role in S phase progression through interaction with other proteins, while its ATP-binding domain is important for regulating mitotic progression mediated by its catalytic activity involving consumption of ATP.
25925375 Combined inhibition of DNA-PKcs and Plk1 can be employed in cancer therapy strategy for synthetic lethality.
25917079 Identify a novel synthetic lethality by dual targeting of mitosis using microtubule-interfering and PLK1-targeted drugs in rhabdomyosarcoma.
25855382 downregulation of SUZ12 and ZNF198 leads to epigenetic reprogramming of infected hepatocytes. Because both Plk1 and HOTAIR are elevated in many human cancers, we propose that their combined effects are involved in epigenetic reprogramming
25830382 IRS2 phosphorylation is cell cycle-regulated and that Plk1 phosphorylation of IRS2 prevents premature mitotic exit via AKT inactivation.
25826089 Gain- and loss-of-function experiments established a direct role for PLK1 in counteracting SN38 antiproliferative and pro-apoptotic effects.
25754767 PLK1 expression was associated with poor tumour differentiation and histopathological high-risk factors. These proteins may be involved in tumorigenesis and progression of disease.
25737075 Data suggest that activity of Plk1 is regulated by Sirt1 contribuing to proper and timely microtubule dynamics and genomic integrity.
25714006 phosphorylation of Rictor at Ser1162 by Plk1 might be involved in a novel signaling pathway.
25697066 High PLK1 expression is associated with Acute Myeloid Leukemia.
25670858 Plk1 regulates the timing of the delocalization and ultimate destruction of the PBIP1.CENP-Q complex.
25666058 Inhibition of Aurora B or expression of the S12A mutant renders reduced interaction between Ataxin-10 and polo-like kinase 1 (Plk1), a kinase previously identified to regulate Ataxin-10 in cytokinesis.
25659891 myotubularin-related protein 3 and myotubularin-related protein 4 may act as a bridge between CEP55 and polo-like kinase 1, ensuring proper CEP55 phosphorylation and regulating CEP55 recruitment to the midbody.
25607646 Plk1 phosphorylated 53BP1 that impairs the ability of 53BP1 to bind the ubiquitinated H2A and to properly localize to the sites of DNA damage.
25592872 PLK1 is implicated in ovarian carcinogenesis and may owe its ability to inhibition of the activity of P53. In addition, misregulation of PLK1 coincident with P53 and P21WAF1 in epithelial ovarian cancer suggests poor prognosis.
25565629 PLK1 protein levels are increased in hamartin and tuberin deficient cells and Lymphangioleiomyomatosis patient-derived specimens, and that this increase is rapamycin-sensitive.
25537513 Data show that microRNA (miR-100) inhibits maintenance and expansion of basal-like breast cancer stem cells (BrCSCs) through Polo-like kinase1 (Plk1) down-regulation.
25524551 Data indicate that polo-like kinase 1 (PLK1) inhibition via mitotic disruption suggeting a potential approach for the treatment of -small cell lung cancer (NSCLC).
25505268 PLK1 inhibition down-regulates polycomb group protein BMI1 via modulation of the miR-200c/141 cluster
25505174 Plk1 inhibition enhances the antineoplastic activity of metformin in prostate cancer
25504441 MCAK activity is modulated by Plk1 phosphorylation on S632/S633 in mitosis.
25501367 STARD9 could be regulated by Plk1 and SCFbeta-TrCP to promote proper mitotic spindle assembly.
25486482 central spindle assembly and 2 Plk1-dependent phosphorylations are required to establish efficient binding of the Ect2 BRCT in early cytokinesis.
25483104 Deficiency of p21 renders tumor cells more susceptible to Polo-like kinase 1 inhibition by showing a pronounced mitotic arrest, DNA damage and apoptosis.
25483079 Recruitment of PLK1 (and BRCA1) to the centrosome in DNA damaged cells induces centrosome amplification.
25480943 Data support a critical role of PLK1 in acquired hormone-independent growth of ER(+) human breast cancer
25430493 Report structure-activity relationships of non-ATP-competitive Plk1 inhibitors.
25398439 PLK1 interacted with and phosphorylated PAX3-FOXO1 at the novel site S503, leading to protein stabilization.
25347426 Decreased PLK1 protein expression due to promoter hypermethylation was negatively correlated with JAK2 overexpression, a common occurrence in hematological malignancies.
25347203 Data indicate that the two hydrogen bond interactions responsible for inhibitors high binding affinity and selectivity for the polo-box domain of Polo-like kinase 1 (Plk1).
25246616 Controlled Plk1 activity is required for gradual biochemical and structural maturation of the centrioles and timely appendage assembly.
25169932 Mitotic arrest and slippage induced by pharmacological inhibition of Polo-like kinase 1.
25047839 Results show that Plk1 phosphorylation of PTEN promotes tumorigenesis.
25036634 Study identifies Plk1 as a centromere-localized regulator required to initiate CENP-A deposition in human cells and faithful CENP-A deposition requires integrated signals from Plk1 and CDK, with Plk1 promoting the localization of the key CENP-A deposition factor, the Mis18 complex, and CDK inhibiting Mis18 complex assembly.
24931513 this study suggests a new mechanism by which Plk1 regulates MCAK: by regulating its degradation and hence controlling its turnover in mitosis.
24893992 Homeostatic control of PLK1 by the dynamic opposition between checkpoint signalling and pro-mitotic activities heterogeneously enforces the G2 checkpoint in each individual cell, with implications for cancer pathogenesis and therapy.
24876664 AURKA and PLK1 are upregulated in colorectal malignancy.
24874015 PLK1 inhibitors display the potential for innovative therapeutic strategies to improve T-ALL patient outcome.
24844881 PLK1 phosphorylates DNA-PKcs on Ser3205 in vitro and interacts with DNA-PKcs in mitosis.
24785407 Expression of NUAK1 is controlled by cyclin-dependent kinase, PLK1, and the SCFbetaTrCP (Skp, Cullin and F-boxbetaTrCP) E3 ubiquitin ligase complex.
24777477 Data suggest that CLIP-170 acts as a novel recruiter and spatial regulator of PLK1 at kinetochores during early mitosis, promoting K-fiber stability and chromosome alignment for error-free chromosome segregation.
24771642 PLK1 overexpression is associated with prostate cancer.
24767679 A 3'UTR polymorphism modulates mRNA stability of PLK1.
24722282 A novel function of LKB1 in the maintenance of genomic stability through the regulation of centrosome mediated by PLK1, is reported.
24706748 Plk1 as an important regulator of PTEN during the cell cycle
24626184 The data provide a model in which p68 and p53 interplay regulates PLK1 expression, and which describes the behavior of these molecules, and the outcome of their interaction, in human breast cancer.
24519995 PLK1 mRNA expression level is not associated with prognosis in childhood ALL
24501426 These results identify a novel mechanism for regulating beta-catenin stability that is independent of GSK3beta and provide new insight into a pathway involving Plk1, Nek2, and beta-catenin that regulates the centrosome cycle.
24498222 p53-Dependent and cell specific epigenetic regulation of the polo-like kinases under oxidative stress.
24484936 Procaspase-8 is regulated during the cell cycle through the concerted inhibitory action of Cdk1/cyclin B1 and polo-like kinase 1 (Plk1).
24482237 Taken together, these results suggest that aurora B coordinates with Plk1 to regulate MyoGEF activation and localization, thus contributing to the regulation of cytokinesis.
24451569 CLIP-170 phosphorylation by Plk1 regulates proper chromosome alignment
24447338 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that PLK1-Vpr interaction affects TNF production from HIV-1 infected cells
24427308 Sorcin links calcium signaling to vesicle trafficking, regulates Polo-like kinase 1 and is necessary for mitosis.
24413556 Plk1 binds to Haspin in a Cdk1-phosphorylation-dependent manner in early mitosis.
24407358 PLK1 abrogates the inhibitory effects of FOXO1 on cell growth and survival to ensure timely cell cycle progression.
24407240 Association of p21 with NF-YA suppresses the expression of PLK1 and prevents mitotic death in response to DNA damage.
24349352 NFBD1/MDC1 is phosphorylated by PLK1 and controls G2/M transition through the regulation of a TOPOIIalpha-mediated decatenation checkpoint.
24338364 Once Plk1 is activated, minimal amounts of the Bora-Aurora-A complex are sufficient to sustain Plk1 activity.
24327015 Growth inhibition following knockdown of NDC80, CDK1 and PLK1.
24271645 It further helps scientists to develop a drug therapy against PLK1 cancer-associated diseases.
24205328 PLK1 is involved in TLR2- and TLR4-induced inflammation
24204733 Data indicate that potent and specific Plk1 inhibitors already in clinical development (BI 2536, BI 6727 and GSK 461364) phenocopied J101 and were selective against glioblastoma-derived neural stem (GNS) cells.
24196446 Here we uncovered an essential role of Polo-like kinase 1 (Plk1) in mechanism of Endocytic vesicle fusion
24166892 Data indicate that DNA-dependent protein kinase catalytic subunit (DNA-PKcs) interacts with polo-like kinase 1 (PLK1) in mitotic phase.
24076372 The model of p53 action on E2F1-activated PLK1 gene may explain at least partly how p53 as a suppressor regulates the downstream effects of E2F1 in cellular stresses including DNA damage stress
24067371 CUL3/KLHL22 may contact two distinct motifs within PLK1 protein, consistent with the bivalent mode of substrate targeting.
24067368 In response to replication stress and DNA damage, BRCA1 plays a critical role in down-regulating the kinase activity of both cyclin-dependent kinases and PLK1.
24032677 calmodulin is a regulatory molecule that associates with Plk1 from G2 to metaphase resulting in considerable stimulation of Plk1 kinase activity leading to hyperphosphorylation of Cdc25C.
24018379 The depletion of FOR20 (FOP-related protein of 20 kDa), a conserved centrosomal protein, inhibits S-phase progression and prevents targeting of Plk1 (polo-like kinase 1) to centrosomes, where FOR20 interacts with Plk1.
23983103 A novel function for CIP2A in facilitating the stability and activity of the pivotal mitotic kinase Plk1 in cell-cycle progression and tumor development.
23977272 Plk1 negatively regulates the RNA polymerase II-dependent transcription through inhibiting the activity of cyclin T1/Cdk9 complex.
23887393 findings show that PDK1-PLK1-MYC signaling is critical for cancer cell growth and survival; PDK1-PLK1-MYC signaling induces an embryonic stem cell-like gene signature associated with aggressive tumor behaviors and is a robust signaling axis driving cancer stem cell self-renewal
23804033 Short interfering RNA-mediated depletion of Kindlin-1 increases formation of abnormal mitotic spindles which is dependent on the ability of Kindlin-1 to bind integrins and Polo-like kinase 1-mediated Kindlin-1 phosphorylation.
23792639 Our findings demonstrate that irrespective of the inhibitor used, the pharmacological inhibition of PLK1 constrains bladder cancer growth and dissemination, providing new opportunities for future therapeutic intervention.
23790466 Data suggest that polo-like kinase 1 (PLK1) is an important therapeutic target for glioblastoma multiforme (GBM) and can enhance radiosensitivity in GBM.
23770244 Results propose a mechanism for the tumor-suppressive role of PLK1 in mammals as an interphase transcriptional regulator.
23757039 The results confirm association of YY1 and PLK1 with outcome in follicular lymphoma and suggest coexpression at the centrosome.
23753023 A pivotal role for PLK1 in pediatric acute lymphoblastic leukemia was determined.
23750008 An actin/myosin-II-binding protein, supervillin (SVIL), is a substrate of PLK1.
23713868 Our data suggest that PLK1 blockage has a radiosensitizing effect on GBM, which could improve treatment strategies for this devastating tumor.
23695676 Mitotic Plk1 activity is regulated not only by Plk1-Thr210 phosphorylation, but also by Plk1 binding to 14-3-3gamma following Plk1-Ser99 phosphorylation downstream of the PI3K-Akt signalling pathway.
23661607 Plk1-asociated kinase activity promotes constitutive activation of androgen receptor in castration-resistant prostate cancer cells.
23643811 phosphorylation on CRY-box by Polo-like kinase-1 is required for Cdh1-dependent degradation of Cdc20 during somatic cell cycle
23615397 Cardiac glycosides potently induce mitotic arrest by the downregulation of polo-like kinase 1 (Plk1) expression.
23574746 Functional p53 strengthens the efficacy of Plk1 inhibition alone or in combination by strongly activating cell death signaling pathways.
23566315 Studies indicate that inhibition of targets outside the main KRAS signaling pathway, specifically the cell cycle related kinase PLK1, has been shown have an effect in cells that harbor mutant KRAS.
23525475 PLK1 knockdown in young cells induced premature senescence. In contrast, upregulation of PLK1 in old cells partially reversed senescence phenotypes. Cell senescence by PLK1 inhibition was observed in p16 knockdown but not in p53 knockdown cells.
23520509 This new in vivo model of CD56(+) AML that recapitulates the human tumour lends support for the therapeutic use of PLK1 inhibitors in AML.
23509069 Plk1 phosphorylates MISP, thus stabilizing cortical and astral microtubule attachments required for proper mitotic spindle positioning.
23494182 Overexpression of Plk1 is associated with invasion of renal cancer.
23455152 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.
23359173 Plk1 was significantly associated with certain clinicopathologic indices in gallbladder carcinoma
23345402 these data suggest a mechanism whereby the recruitment of Plk1 to pericentriolar matrix by PCM1 plays a pivotal role in the regulation of primary cilia disassembly before mitotic entry.
23188630 Gemcitabine resistance is dependent on Plk1-mediated phosphorylation of Orc2 and Hbo1.
23151088 MiR-100 mimics could significantly inhibit PLK1 mRNA and protein expression.
23144294 Polo-like kinase 1 (PLK1) was found to be significantly overexpressed in TNBC compared with the other breast cancer subtypes
23105120 These results demonstrate that different thresholds of Plk1 activity can elicit distinct phenotypes.
23079597 The PLK1 and BUBR1 cooperate to stabilize kinetochore-microtubule interactions by regulating PP2A-B56alpha-mediated dephosphorylation of Aurora B substrates at the kinetochore-microtubule interface.
23063527 The CDK1/Cyclin B1 phosphorylates Gravin on threonine 766 to prime the recruitment of the polo-like kinase Plk1 at defined phases of mitosis.
23047923 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that PLK1-Vpr interaction affects TNF production from HIV-1 infected cells
23046929 Non-phosphorylatable mutant of Plk1 (Plk1(S330/597A);) induces cytokinesis failure and causes the cell cycle arrest at G2/M phase.
23045552 propose that Cdk1 and Plk1 mediate a fine CLASP2 "phospho-switch" that temporally regulates kinetochore-microtubule attachment stability
23037713 FOXM1 and PLK1 are expressed in oesophageal adenocarcinoma-derived cell lines.
22918237 4E-BP1, beyond its role in translation regulation, can function as a regulator of mitosis via interacting with PLK1, and possibly plays a role in genomic stability maintaining.
22908307 Plk1 dynamics at kinetochores control two critical mitotic processes: initially establishing correct kinetochore-microtubule attachments and subsequently silencing the spindle checkpoint.
22892842 These results thus suggest a potential of using PLK1 inhibitors for the treatment of pancreatic cancer
22890325 LNCaP-AI cells underwent reprogramming in both their cell growth and cell death pathways, rendering them highly sensitive to Plk1 inhibition that induces necroptosis
22869522 Plk1 is required for the kinetochore localization of Sgt1 and phosphorylates serine 331 of Sgt1 at the kinetochores.
22863584 Plk1 is a serine/threonine protein kinase that plays multiple critical roles in centrosome maturation, mitotic chromosome segregation, cytokinesis, and the DNA damage response.
22826617 Knockdown of PLK1 overexpression in hepatocellular carcinoma was shown to be a potential therapeutic target, leading to apoptosis through the endonuclease-G pathway.
22820163 Plk1-mediated phospho-dependent centrosomal localization of Tara is important for faithful chromosome segregation, and provided novel insights into understanding on the role of Plk1 in cooperation with Tara in mitotic progression.
22818914 Phosphorylation of NEDD1 on Ser77 by Nek9 requires activation of Nek9 by Plk1-dependent phosphorylation.
22795848 analysis of tumor imaging using polo-box domain of polo-like kinase 1 targeted peptide
22753416 Fry also binds to Aurora A and promotes Plk1 activity by binding to the polo-box domain of Plk1 and by facilitating Aurora A-mediated Plk1 phosphorylation at Thr-210.
22753241 results provide a new insight into the proliferative status of colon tumor-initiating cells both in basal conditions and in response to therapy and indicate Plk1 inhibitors as potentially useful in the treatment of colorectal cancer.
22701722 The centrosomal kinase Plk1 localizes to the transition zone of primary cilia and induces phosphorylation of nephrocystin-1.
22648245 PLK1 could be a progression marker for colorectal cancer patients.
22641346 An MYPT1 mutant (S445A) failed to dephosphorylate Thr 210 of PLK1 (pololike kinase 1), thereby activating PLK1.
22621898 findings suggest that PRC1 is regulated by Plk1, rather than Cdk1 as previously proposed, because its activity must be spatiotemporally regulated both preanaphase and postanaphase, and Cdk1 activity is too binary for this purpose
22609948 Identification of a novel Wnt5a-CK1varepsilon-Dvl2-Plk1-mediated primary cilia disassembly pathway.
22593191 Dysregulation of Numb expression results in mislocalized Plk1 and poor centrosomal gamma-tubulin recruitment, potentially contributing to mitotic errors, aneuploidy, and cancer development.
22566210 Plk1's activation-loop phosphorylation is both essential and irreplaceable during M phase.
22535524 Data show that Polo-like kinase 1 (Plk1) regulates both the localization and activity of kinesin-13 protein Kif2b during mitosis to promote the correction of k-MT attachment errors to ensure mitotic fidelity.
22467873 GRK5 phosphorylates Ser-4 in nucleophosmin and regulates the sensitivity of cells to PLK1 inhibition.
22427657 Data indicate that Plk1 siRNA interference and overexpression increased phosphorylation of RSK1, suggesting that Plk1 inhibits RSK1.
22405092 Breast cancer patients expressing elevated PLK1 expression show significantly reduced survival.PLK1 in primary breast cancer is associated with TP53 mutation and poor clinical outcome.
22391203 Tip60 forms a ternary complex with Plk1 and cyclin B1 and acetylates Plk1 but not cyclin B1.
22391203 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that PLK1-Vpr interaction affects TNF production from HIV-1 infected cells
22390279 Inhibition of PLK1 impaired tumor sphere formation of medulloblastoma cells and decreased the expression of SRY (sex determining region Y)-box 2 (SOX2) mRNA in tumor spheres indicating a possible role in targeting tumor inititiating cells.
22365832 Plk1 phosphorylates Optineurin (Optn) at serine 177 and that this dissociates Optn from the Golgi-localized GTPase Rab8, inducing its translocation into the nucleus.
22325354 Our results uncover a role of Plk1 in linking DNA damage recognition with homologous recombination repair
22314839 IRE1a-mediated induction of apoptosis and inhibition of proliferation in response to endoplasmic reticulum stress is through downregulation PLK1.
22309939 PLK1 was universally expressed in breast cancer cell lines, representing all of the breast cancer subtypes, and was positively correlated to CD44
22281053 Plk1 associates with tRNA and 5S rRNA genes and regulates their transcription by RNA polymerase III (pol III) through direct binding and phosphorylation of transcription factor Brf1.
22262171 The cytotoxicity resulting from PLK1 inhibition is elevated in cancer cells with defective p53.
22249248 Data indicate that miR-100 reduction was paralleled by an increased expression of polo like kinase 1 (PLK1).
22192978 Data indicate that polo-like kinase 1 (Plk1) expression was closely correlated with important histopathologic characteristics (grades and stages) and the recurrence and metastasis of bladder urothelial carcinomas.
22188812 Data indicate that TAK-960 is a potent and selective inhibitor of polo-like kinase 1 (PLK1).
22184200 The PLK1-mediated phosphorylation of PCNT initiates centrosome maturation by organizing the spindle pole-specific PCM lattice.
22184120 the existence of a p53-Plk1-Cep55 axis in which p53 negatively regulates expression of Cep55, through Plk1 which, in turn, is a positive regulator of Cep55 protein stability.
22154349 analysis of PLK1 inhibition by 5-(2-amino-pyrimidin-4-yl)-1H-pyrrole and 2-(2-amino-pyrimidin-4-yl)-1,5,6,7-tetrahydro-pyrrolo[3,2-c]pyridin-4-one derivatives
22120675 Data suggest that down-regulation of miR-100 could lead to Plk1 over-expression and eventually to docetaxel chemoresistance of lung adenocarcinoma.
22115795 The overexpression of Plk1 or Pin1 inhibited apoptotic signals following the cleavage of PARP in 5'-NIO-treated cells.
22108192 Increased activity of Stat3 and overexpression of PLK1 promote survival and proliferation of esophageal squamous cell carcinoma cells in culture and in mice.
22064247 High polo-like kinase 1 protein expression is an independent prognostic molecular marker for non-small cell lung cancer. patients
22000864 the expression of PLK1 mRNA was significantly higher in glioma tissues than in corresponding normal brain tissues
21987589 Sororin is phosphorylated by Cdk1/cyclin B at prophase and acts as a docking protein to bring Plk1 into proximity with SA2, resulting in the phosphorylation of SA2 and the removal of cohesin complexes from chromosomal arms.
21978935 Polo-like kinase 1 (Plk1) failed to phosphorylate the Aur-A-unphosphorylatable FADD substitution mutant S203A.
21953073 High PLK1 expression is associated with brain metastasis in breast cancer.
21947279 Plk1 phosphorylation of Orc2 promotes DNA replication under conditions of stress
21890624 a role of Plk1 in facilitating loss of Pten-induced prostate cancer formation
21887822 Results reveal that Hsp70 is a novel substrate of Plk1 and that its phosphorylation contributes to attenuation of ATO-induced mitotic abnormalities.
21880710 Plk1-mediated phosphorylation of Rio2 regulates metaphase-anaphase transition during mitotic progression.
21857149 Plk1 phosphorylates Ataxin-10 on Ser 77 and Thr 82.
21857030 we have identified many PLK1 protein substrates with the D/E-x-S/T and N-x-S/T motifs which represent a new subclass of PLK1 motifs
21818122 Phosphorylation of TNKS1 by Plk1 may help regulate mitotic spindle assembly and promote telomeric chromatin maintenance.
21816470 PLK1 inhibition is a potential new strategy for the treatment of multiple myeloma.
21813642 in vitro and in vivo phosphorylation of RanBP1 by Plk1 as well as the importance of phosphorylation of RanBP1 in the interaction between Plk1 and Ran during early mitosis, is demonstrated.
21768102 auto-ubiquitylation of E3 ubiquitin-protein ligase Chfr at G2 phase is required for accumulation of polo-like kinase 1 and mitotic entry in mammalian cell
21750699 Data indicate that PLK 1 inhibitor BI 2536 showed potent and rapid cell death in vitro activity against MM cells in isolation, as well as in vivo activity against a traditional subcutaneous xenograft mouse model.
21726628 Suppression of Polo like kinase 1 (PLK1) by p21(Waf1) mediates the p53-dependent prevention of caspase-independent mitotic death.
21723128 Centrosome disjunction is regulated by Plk1, providing a well-balanced control between the counteracting Nek2A and PP1gamma activities on the centrosome linker.
21690413 via the formation of the Nedd1-Plk1 complex and subsequent Augmin phosphorylation, Plk1 regulates spindle MT-based MT nucleation to accomplish normal bipolar spindle formation and mitotic progression
21642957 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
21640712 there are 13 sites phosphorylated by PLK1 in CDC25B.
21636267 PLK1 expression was negatively correlated with miR-100 expression in cervical intraepithelial neoplasia and cervical cancer tissues.
21635870 These results suggest that RNF8 is downregulated in many cancer cells and inversely correlated with Plk1.
21610149 PLK1 protects esophageal carcinoma cells from anoikis through modulation of beta-catenin protein levels by inhibiting their degradation.
21602893 role in tumorogenesis of cutaneous squamous cell carcinoma
21576470 polo-like kinase 1 activity regulates diffusion to maintain centrosome self-organization during mitosis
21533207 Analysis on hMps1 autophosphorylation sites demonstrates that hMps1 has a substrate preference similar to Plk1 kinase
21522128 The authors report that in G2 phase polo-like kinase 1 (Plk1) can trigger centrosome separation independently of Cdk1 by phosphorylating the motor protein Eg5.
21519187 Phosphorylation of Cdc6 by polo-like kinase 1 (Plk1), one of the essential mitotic kinases, regulates mitotic exit.
21507953 Plk1 is a dynein kinase required for recruitment of phosphorylated dynein to kinetochores.
21480320 We propose Plk1 activity down-regulates ZNF198 and SUZ12, thereby enhancing both HBV replication and pX-mediated oncogenic transformation.
21474997 Polo-like kinase 1 regulates activation of AMP-activated protein kinase (AMPK) at the mitotic apparatus.
21454580 Mammalian polo-like kinase 1-dependent regulation of the PBIP1-CENP-Q complex at kinetochores.
21436619 Polo-like kinase 1 (Plk1) is expressed by cutaneous T-cell lymphomas (CTCLs), and its downregulation promotes cell cycle arrest and apoptosis.
21399492 the PLK1 inhibitor, BI 2536, inhibits proliferation and induces apoptosis in two-dimensional and three-dimensional cultures of osteosarcoma cell lines, KHOS and U-2OS.
21330050 Polo-like kinase 1 contributes to the tumorigenicity of hepatoma cells via regulation of Survivin expression
21271384 PLK1 silencing by siRNA may inhibit the migration and invasiveness of colorectal cancer cells.
21253604 Plk1 directly phosphorylates YY1 in vitro and in vivo at threonine 39 in the activation domain. We show that this phosphorylation is cell cycle regulated and peaks at G2/M.
21242189 Data show that Polo-like kinase-1 is a potential therapeutic target in neoplastic mast cells.
21184800 inhibition of Plk1 may have potential use as a therapeutic strategy in multiple myeloma.
21170987 PLK1 is post-transcriptionally regulated by miR-593* and could be a promising molecular target for EC treatment.
21169242 Elevated PLK1 expression is significantly associated with high-risk neuroblastoma and unfavorable patient outcome
21148584 The PLK1-mediated priming phosphorylation is critical for orchestrating Aurora B activity in centromere which is essential for accurate chromosome segregation and faithful completion of cytokinesis.
21079244 Data show that Plk1 activity negatively regulates Cep55 to ensure orderly abscission factor recruitment and ensures that this occurs only once cell contraction has completed.
21078677 dynamic regulation of MCAK phosphorylation by PLK1 is required to orchestrate faithful cell division
21051833 The positive rates of PLK1 were significantly higher in gastric cancer than in peritumoral tissues and different types of benign lesions.
21041660 Plk1-mediated phosphorylation of Cdc6 promotes the interaction of Cdc6 and Cdk1, leading to the attenuation of Cdk1 activity, release of separase, and subsequent anaphase progression.
20962589 These data establish PLK1 as a direct transcriptional target of p53, independently of p21, that is required for efficient G/M arrest.
20937827 the mechanism of phosphoinhibition as direct inhibition by PLK1 of the PDZ ligand underlying the GRASP65 self-interaction.
20890306 our data demonstrate that in response to taxol, Plk1 endows death-promoting and tumor-suppressor functions to its substrate, FADD
20869364 Data suggest that function of Plk1 could be controlled by kinases for proper mitotic progression.
20860994 These data provide a rich source of information on Plk1-dependent phosphorylation, Plk1 docking to substrates, the influence of phosphorylation on protein localization, and the functional interaction between Plk1 and Aurora A on the early mitotic spindle.
20823832 These results suggested that Dvl2 is involved in mitotic progression by regulating the dynamics of MT plus-ends and the SAC in Plk1-dependent and -independent manners.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20679239 Data show that polo-like kinase 1 phosphorylation of p150(Glued) might be one major pathway of NEBD regulation.
20664522 Herein, the authors have identified polo-like kinase 1 (Plk1) and casein kinase 2 (CK2) as two kinases of CLIP-170 and mapped S195 and S1318 as their respective phosphorylation sites.
20656208 Plk1 coordinates the centriole duplication cycle with the cell cycle.
20624918 novel Plk1 mechanism initiates pX-mediated hepatocyte transformation.
20622363 High PLK1 is associated with cervical cancer.
20615875 Results highlight dual ASAP regulation by Plk1 and further confirm the importance of ASAP for spindle pole organization, bipolar spindle assembly, and mitosis.
20581453 Inhibition of plk1 through dephosphorylation was dependent on AtM/Chk1 activity
20581060 Data suggest that PLK1 may be a novel predictive marker for radiation response as well as a promising therapeutic target in rectal cancer patients.
20577264 Data show that G2 and S-phase-expressed 1 (GTSE1) protein, a negative regulator of p53, is required for G2 checkpoint recovery and that Plk1 phosphorylation of GTSE1 promotes its nuclear localization.
20573420 Plk1-mediated phosphorylation of PinX1 at five phosphorylation sites is essential for its Plk1-induced degradation.
20534861 This study shows that Plk1 is an NS5A phosphokinase and thereby indirectly regulates hepatitis C virus RNA replication.
20511645 Data propose that centrobin functions as a microtubule stabilizing factor and PLK1 enhances centrobin activity for proper spindle formation during mitosis.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20484576 These findings reveal that the scaffold protein TANK recruits PLK1 to negatively regulate NF-kappaB activation and provide direct evidence that PLK1 is required for the repression function of TANK.
20470222 Data show that polo-like kinase 1 depletion hampered the cell cycle progress of cells recovered from DNA damage, and induced apoptosis.
20427271 Phosphorylation of survivin at Ser(20) by Plk1 kinase is essential for accurate chromosome alignment and cell proliferation but is dispensable for its anti-apoptotic activity in cancer cells.
20404504 Inhibition of polo-like kinase 1 reduces the phosphorylation of RPS6 and 4E-BP1.
20198330 Knockdown of both PLK1 and HSF1 expression decreased cell proliferation while increasing apoptotic cell death in synergistic fashion in oral carcinoma cells.
20170163 Studies show the design and development of dual VEGF-R2/PLK1 inhibitors.
20146883 PLK1 mRNA is over-expressed in pterygia, indicating a probable role for PLK1 in their development.
20145140 Plk1 is expressed in chronic myeloid leukemia (CML) cells and may represent a novel, interesting target in imatinib-sensitive and imatinib-resistant CML.
20130082 the PICH-Plk1 complex plays a critical role in maintaining prometaphase chromosome architecture
20103597 polo-like kinase 1 is a mediator of gemcitabine resistance in pancreatic cancer
20089605 a role for Plk1 in the loss of checkpoint control, increased survival and mutagenesis after genotoxic exposure in normal cells
19855194 DH166 blocks cancer cell proliferation, causes a mitotic arrest, increases cyclin B1 accumulation, induces aberrant mitotic spindles and apoptosis, presumably due to the downregulation of PLK1
19833129 Data show that the PLK1 phosphorylates MDM2 at Ser260 and stimulates MDM2-mediated turnover of p53.
19822658 Results underscore the crucial role of cyclin A2-CDK2 in regulating the PLK1-SCF(beta-TrCP1)-EMI1-APC/C axis and CDC6 to trigger genome reduplication after the activity of CDK1 is suppressed.
19821153 Polo-like kinase 1 (Plk1)-associated phosphorylation of Topors at S718 is essential for nocodazole-induced degradation of Topors.
19804365 Cancer Osaka thyroid (Cot) protein, expressed in HEK293 cells and immunoprecipitated, was used in a peptide-based substrate screening assay. The results of this assay suggested that Polo-like kinase 1 (Plk1) was a substrate of Cot.
19775446 targeting PLK-1 might be a promising strategy for enhancing sensitivity to chemotherapeutic reagents in cervical carcinoma.
19758559 Plk1 and separase act at different times during M phase to license centrosome duplication, reminiscent of their roles in removing cohesin from chromosomes
19739117 underexpressed miR-100 leads to Plk1 overexpression, which in turn contributes to nasopharyngeal cancer progression.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19725153 Overexpression of polo-like kinase1 predicts a poor prognosis in hepatocellular carcinoma patients.
19706541 Data show that PLK2 as a kinase that phosphorylates Ser-137 of PLK1, which is sufficient to mediate this survival signal.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690138 Selective inhibition of PLK1 activity induced cell growth arrest in most proliferating cancer cell lines tested
19668228 Plk1 controls TAp63 by its phosphorylation and regulates apoptotic cell death in liver tumor cells.
19631697 a transportin-dependent nuclear localization signal is present in the polo box domain of Plk1, possibly required for efficient nuclear import. The 38 amino acid sequence identified here likely represents a novel nuclear localization signal.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19597481 The mode of interaction between the minimal peptide and PBD may provide a template for designing therapeutic agents that target PLK1.
19572149 Data indicate that overexpression of Plk1 may play an important role in carcinogenesis and malignant progress of ESCC.
19554017 Plk1 may have a functional relevance toward melanoma development and/or progression
19546225 Polo-like kinase 1 (PLK1) regulates interferon (IFN) induction by MAVS
19543530 Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components
19509060 Data suggest that sequential phosphorylation of Nedd1 by Cdk1 and Plk1 plays a role in targeting gamma tubulin ring complex to the centrosome by promoting the interaction of Nedd1 with the gammaTuRC component gamma-tubulin, during mitosis.
19503101 Results unravel a crucial role of BubR1 in preventing centrosome reduplication through negative regulation of Plk1 in interphase cells.
19487276 Recent advances in the understanding of the functional crosstalk between Plk1 and Aurora-A before and during mitosis.
19473992 Plk1 modulates Topors activity in suppressing p53 function
19468302 Data found that Plk1 binds and directly phosphorylates the HsCYK-4 at the midzone and this modification creates a major docking site for the tandem BRCT repeats of the Rho GTP exchange factor Ect2.
19468300 Data showed how Plk1 promotes the central spindle recruitment of Ect2. Plk1 phosphorylates the noncatalytic N terminus of the RhoGAP HsCyk-4 at the central spindle, creating a phospho-epitope recognized by the BRCA1 C-terminal (BRCT) repeats of Ect2.
19458358 Plk1 is highly expressed in leukemic cell lines, and overexpressed in a majority of samples from patients with acute myeloid leukemia
19452252 positive cell percentages of Plk1 and Ki-67 were both correlated with overall survival in DLBCL
19400994 interaction of the meiotic structures and chromosome segregation in oocytes were studied; it was found that Plk1 was localized in the spindle midzone in oocytes at anaphase I and telophase I
19386263 A splice variant of hODF2 called hCenexin1, but not hODF2 itself, efficiently localizes to somatic centrosomes via a variant-specific C-terminal extension and recruits Plk1 through a Cdc2-dependent phospho-S796 motif within the extension.
19351716 Data show that Kif2a is regulated positively by Plk1 and negatively by Aurora A, and suggest that this antagonistic regulation confers differential stability to microtubules in the spindle versus at the pole versus in the cytosol.
19289504 Data suggest that Plk1 is required for cell cycle progression not only in mitosis but also for DNA synthesis, maintenance of DNA integrity, and prevention of cell death.
19177004 Data demonstrate that the long-term suppression of Plk1 increases the levels of cyclin-dependent kinase inhibitor p21(WAF1/CIP), which is partially induced by the elevated tumor suppressor p73 in p53-inactivated HeLa cells.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19160488 Plk1-dependent regulation of FoxM1 activity provides a positive-feedback loop ensuring tight regulation of transcriptional networks essential for orderly mitotic progression.
19152411 Through a yeast two-hybrid screening, human polo-like kinase 1 was found to interact with human papillomavirus type 5 E2.
19033445 demonstrate the predominant role of polo box domain-dependent binding on smooth chromosome congression at metaphase
19004025 PLK1 might be a useful prognostic marker and a potential therapeutic target for esophageal squamous cell carcinoma
18980975 Metastatic HCC cells showed a defective S-M checkpoint following cisplatin treatment and potential aberrant checkpoint adaptation, which might result from deregulation of Plk1-Cdc25A pathway.
18957422 Regulation of I(kappa)B kinase complex by phosphorylation of (gamma)-binding domain of I(kappa)B kinase (beta) by Polo-like kinase 1.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18922800 mechanistic roles contributed by protein phosphorylation and Plk1 to the spindle assembly checkpoint activity of Mad1
18854154 Knockdown of polo-like kinase 1 (PLK1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18820703 These observations suggest that Plk1 is a regulator of Bcl-x(L) phosphorylation and controls the anti-apoptotic activity of Bcl-x(L) during pironetin-induced apoptosis.
18695677 Only Plk1-S326E, but not the Plk1-S326A, efficiently rescued the p38 or MK2-depletion-induced mitotic defects, further solidifying the requirement of S326 phosphorylation during mitotic progression
18694934 Plk1 can regulate MyoGEF activity and localization, contributing to the regulation of cytokinesis
18676680 Observational study of gene-disease association. (HuGE Navigator)
18662541 In response to genotoxic stress in G2, the phosphatase Cdc14B translocates from the nucleolus to the nucleoplasm and induces the activation of the ubiquitin ligase APC/C(Cdh1), with the consequent degradation of Plk1, a prominent mitotic kinase.
18625707 Plk1 interacts with and phosphorylates TRF1 and Plk1-mediated phosphorylation is involved in both TRF1 overexpression-induced apoptosis and its telomeric DNA binding ability
18616938 in U937 AML cells, PLK1 participates in checkpoint recovery, and that inhibition of PLK by the GW843682X compound results in mitotic accumulation and apoptosis
18615013 data demonstrate that the initial activation of PLK1 is a primary function of aurora A
18566290 study reports that the synergistic action of Bora & the kinase Aurora A controls G2-M transition; Bora accumulates in G2 phase & promotes Aur-A-mediated activation of Polo-like kinase 1, leading to activation of cyclin-dependent kinase 1 & mitotic entry
18560274 Plk1 is phosphorylated in the starting M-phase, and this phosphorylation induces polo-box targeting through a possible conformational change.
18547964 PLK1 overexpression is an adverse predictive factor in NHL
18521620 Plk1 controls Aurora A localization and function by regulating cellular levels of hBora.
18477460 These results identify a previously unrecognized role for MYPT1 in regulating mitosis by antagonizing PLK1.
18445273 HIV-1 Vpr R80A mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that PLK1-Vpr interaction affects TNF production from HIV-1 infected cells
18427546 activity is regulated by p21-activated kinase and leads to mitotic progression
18418051 TAp73-mediated activation of the p21(cip/waf), 14-3-3sigma and Bax gene promoters is abrogated by expressed PLK1 for which post-translational modification of TAp73 Thr-27 appears to be a key step in MCF7 cells.
18391401 the first crystal structure of the kinase domain of wild-type apo Plk-1, in complex with designed ankyrin-repeat proteins, is presented
18378770 Proteolysis of Bora requires the Plk1 kinase activity and is mediated by SCF-beta-TrCP; Plk1 phosphorylates a conserved DSGxxT degron in Bora and promotes its interaction with beta-TrCP.
18353325 Cyclin B1 and Plk1 may play important roles in the pathogenesis of endometriosis by mediating ectopic endometrial cell proliferation under regulation of ovarian hormones.
18331714 Centriole splitting induced by Sgo1 depletion or expression of a dominant negative mutant is suppressed by ectopic expression of sSgo1 or by Plk1 knockdown.
18298903 Expression of PLK1 in non-Hodgkin lymphoma treated with CHOP is reported.
18298087 Phosphorylation and the presence of the PBD-binding phosphopeptide result in an increase in catalytic efficiency of 1515x with a 2.3-fold decrease in K(M) and a 705-fold increase in k(cat) over the unmodified Plk1.
18297112 cancer cell lines have a much greater requirement for Plk1 than normal nontransformed diploid cells
18278450 Plk1 inhibition could significantly inhibit cell proliferation and induce cell cycle arrest and apoptosis
18250300 Plk1 phosphorylation of Hbo1 may be required for prereplicative complex (pre-RC) formation and DNA replication licensing
18174154 Plk1-mediated dysfunction of p73 is one of the novel molecular mechanisms to inhibit the p53-independent apoptosis
18171681 Plk1-dependent phosphorylation regulates functions of DNA topoisomerase IIalpha in cell cycle progression
18062778 topoisomerase IIalpha is a novel physiological substrate for Plk3, and Plk1 and Plk3 play different roles in cell-cycle regulation.
18056432 Over expression of Polo-like kinase 1 is associated with preinvasive in situ carcinomas of the breast
17943598 Compared with survivin, PLK1 seems to be a better independent prognostic factor for diffuse large B-cell lymphoma.
17671160 Plk1 activity is essential for cleavage furrow formation and ingression, leading to successful cytokinesis.
17635521 Co-immunoprecipitation reveals that RhoA and polo-like kinase 1 physically interact and that their interaction appears to be enhanced during mitosis.
17623655 PLK1-HsCdc14A interaction provides a temporal regulation of HsCdc14A in chromosome segregation during mitosis.
17617734 Shugoshin 1 plays a central role in kinetochore assembly and is required for kinetochore targeting of Plk1.
17610829 New work has now identified PRC1 as a Plk1-delivery factor that is tightly controlled by opposing cyclin B-Cdk1- and Plk1-dependent phosphorylations.
17488623 Late mitotic Plk1 activity promotes recruitment of Ect2 to the central spindle, triggering the initiation of cytokinesis and contributing to cleavage plane specification in human cells.
17476331 results demonstrate that Plk1 coordinates chromosome segregation with cytokinesis through its dual control of anaphase B and contractile ring assembly
17461553 Crystallized structures of Plk1 reveal the typical kinase fold with the unphosphorylated activation loop in an extended conformation, stabilized by a crystal contact.
17446864 Plk1 and RhoA function to enhance Rock2 kinase activity in vitro and within cells, and implicate Plk1 as a regulator of multiple pathways that synergistically converge to regulate actomyosin ring contraction during cleavage furrow ingression.
17434144 These findings suggest that PLK-1 plays a critical role in the proliferation of RA synoviocytes leading to bone destruction, and siRNA against PLK-1 is potentially useful for the treatment of RA.
17376779 Plk1 facilitates chromosome alignment during prometaphase through BubR1.
17360533 Polo-like kinase 1 has a role in positioning RhoA and triggering cytokinesis in human cells
17359284 Results suggest that an onocogenic role of overexpressed cyclin B1 is mainly mediated in nuclei of breast carcinoma cells, and the nuclear translocation is regulated by polo-like kinase 1 and 14-3-3sigma.
17351902 siRNA-induced suppression of Plk1 expression effectively reduced the viable cell mass and increased apoptosis in several cancer cell lines
17351640 Choice of Plk1 docking partners during mitosis and cytokinesis is controlled by the activation state of Cdk1.
17310276 TTDN1 is phosphorylated in mitosis, and this is required for its interaction with polo-like kinase 1.
17265445 correlation between COX-2 and PLK-1 in a malignant prostate tumor
17253180 Gastric cancer patients with plk1-positive expression had worse prognosis than those with plk1-negative expression.
17218258 These data identify PICH as a novel essential component of checkpoint signaling.
17121863 a novel pathway, which is connected between ataxia telangiectasia-mutated kinase (ATM) and protein phosphatase-Plk1 in DNA damage response in mitosis
17121839 a nitric oxide-p38 MAPK-p21/Waf1 signal transduction pathway represses PLK1 through a canonical CDE/CHR promoter element
17102638 Plk1 has a role in mitotic arrest, which is released by Chk1
17081991 Plk1 self-regulates the Plk1-PBIP1 interaction to timely localize to the kinetochores and promote proper chromosome segregation.
17005603 Intranuclear OPN participates in the process of cell duplication and associates with Plk1
16966375 We propose that hCenexin1 is a critical centrosomal component whose C-terminal extension is required for proper recruitment of Plk1 and other components crucial for normal mitosis.
16934469 The degradation of Claspin upon mitotic entry depends on Plk1.
16930555 Plk1 regulates the spindle organization partially through its phosphorylation on Ran
16927022 Either chk1 or plk1-specific antisense oligodeoxynucleotides enhanced DNA damaging agent-induced apoptosis.
16873548 Checkpoint kinase 1 (Chk1) is required for mitotic progression through negative regulation of polo-like kinase 1 (Plk1)
16865274 Overexpression of Polo-like kinase 1 is associated with human gastric carcinomas
16860740 NudC functions as both a substrate and a spatial regulator of Plk1 at the kinetochore to promote chromosome congression.
16837776 Tumors with PLK1 overexpression were associated more frequently with CIN, DNA aneuploidy and centrosome amplification. Overexpression of PLK1 was significantly related to higher pathological grade, multiple tumors and positive urine cytology.
16760428 Phosphorylation of Bub1 at T609 by Cdk1 creates a docking site for the PBD of Plk1 and facilitates the kinetochore recruitment of Plk1.
16753148 Cdc25C may first be actived by Plk1, and then its phosphatase activity makes p53 dephosphorylated at Ser15
16648550 Phosphorylation of cdc25c can be used to test whether a pharmacologic inhibitor of Plk1 would exert the same cellular effects as interference with Plk1 on an mRNA level.
16630118 Overexpression of PLK1 is associated with gastric cancer
16582488 The polo box domain in complex with a phosphorylated peptide is examined crystallographically.
16478733 the Polo box domain of Plk3 is more potent in inhibiting cell proliferation and inducing apoptosis than that of Plk1
16469711 Data show that knocking down PLK1 (Polo-like kinase 1) mRNA in colorectal cancer cell with small interfering RNA (siRNA) blocked the mitosis and growth of the tumor cell.
16378098 The complex formation of Plk1 and Aurora-B on INCENP may play crucial roles in the regulation of chromosomal dynamics.
16267267 whereas chromosome congression requires localized Plk1 activity, other investigated Plk1 functions are less dependent on correct polo-box domain-mediated targeting
16260496 Cdk1 regulated mitotic vimentin phosphorylation via not only a direct enzyme reaction but also Plk1 recruitment to vimentin.
16254247 Plk1 helps to coordinate changes in microtubule organization with cell cycle progression, by controlling the dynein-dynactin-dependent transport of centrosomal proteins.
16247472 ECT2 is regulated by Plk1
16237758 The expression patterns and prognostic implications of the mitotic regulator Polo-like kinase 1 in colon cancer are reported.
16198290 Results highlight the centrosome as a site to organize phosphorylation of Cep55 by Erk2/Cdk1 and Plk1, enabling it to relocate to the midbody to function in mitotic exit and cytokinesis.
16157594 DNA damage-induced inhibition of Plk1 leads to inhibition of Nek2 activity and thus prevents centrosome separation
16127294 Study suggests that PLK1 expression significantly reflects aggressive characteristics of medullary thyroid carcinoma.
15923617 Data show that Plk1 associates with chaperonin-containing TCP1 complex (CCT) both in vitro and in vivo.
15876876 Plk1 Polo box domain mediates a cell cycle and DNA damage regulated interaction with Chk2
15855824 PLK1 was found overexpressed in pancreatic neoplasia as early as in pancreatic intraepithelial neoplasia III lesions, whereas benign acinar pancreatic parenchyma and ductal epithelia showed only focal PLK1 positivity.
15713655 Plk1 function is altered at different stages of mitosis through phosphorylation of Ser-137 and Thr-210.
15678101 Plk1-dependent signalling mechanism potentially linking Golgi structure and cell cycle control
15664519 The polo-like kinase 1 activity and expression in complex proteomes is rapid detection by AX7503.
15661849 study suggested that polo-like kinase 1 (Plk1) plays a critical role in the process of prostate cancer development
15661742 phosphorylation of HSF1 by PLK1 is an essential step for HSF1 nuclear translocation by heat stress
15654075 interaction between endogenous Plk1 and Mcm7 was detected in a soluble chromatin fraction. These findings suggest a new function for Plk1 in coordination of DNA replication and mitotic events.
15616186 Cep170 interacts with Polo-like kinase 1 in mature centrioles
15611664 in vivo phosphorylation of Plk1 at serine 137 (S137) and threonine 210 (T210) occurs in mitosis; DNA damage prevents phosphorylation of Plk1 at both S137 and T210 in asynchronous cells but not in mitotic cells
15469984 Plk1 activates the anaphase promoting complex by directing the SCF-dependent destruction of Emi1 in prophase
15458642 Plk-1 is required for proper spindle assembly and function.
15350223 The cell cycle machinery is reset in response to DNA damage and that cells become critically dependent on Plk1-mediated degradation of Wee1 for their recovery.
15280449 Treatment of mitotic cells with DNA damaging agents inhibits Plk1 activity primarily through dephosphorylation of Plk1.
15210710 Plk1 has a role in bipolar spindle formation but is not necessary for APC/C-Cdc20 activation and initiation of cytokinesis
15199097 Plk1 and CHO1/MKLP-1 interact to have a role in cytokinesis
15190079 the role of Plk1 in mitosis regulation through the identification of Ser-4 in B23 nucleophosmin as a major physiological substrate of Plk1
15176053 High rate of PLK-1 positivity seen in prostate cancer; PLK1 may be involved in prostate cancer tumorigenesis and progression
15141022 Antisense-treated pancreatic cancer cells showed cell cycle arrest in G(2)-M as well as a drastic reduction in proliferation rates
15125835 Mitotic phosphorylation of Nir2 is required for docking of the phospho-Ser/Thr binding module, the Polo box domain of Plk1, and overexpression of a Nir2 mutant, which fails to interact with Plk1, affects the completion of cytokinesis.
15105433 Data demonstrate that Plk1 (Polo-like kinase 1) is a target of the retinoblastoma tumor suppressor (RB) pathway.
15024021 p53 is a critical target of Plk1, and its function is abrogated through the physical interaction with Plk1.
15015605 PLK1 regulates the cell cycle progression of thyroid lymphoma cells in the G2-M-phase.
14735186 PLK1 does not act as a cell cycle regulator but plays a constitutive role in papillary carcinoma especially in the early phase, and may contribute to the malignant transformation of this carcinoma
14734534 A putative destruction box in Plk1 is required for degradation of Plk1 in anaphase.
14654792 Cell cycle arrest at G2/M after ionizing radiation (IR) of breast carcinoma cells may involve repression of the gene for Plk1.
14592974 crystal structure of Plk1 polo box domain provides an explanation for phospho-peptide recognition
14532005 Data show that the Polo-box domains of human, Xenopus, and yeast polo-like kinases all recognize similar phosphoserine/threonine-containing motifs
12939256 Data suggest that phosphorylation of mitotic kinesin-like protein 2 by polo-like kinase 1 (Plk1) is necessary for the restriction of Plk1 to the spindle during anaphase and telophase, and the complex of these two proteins is required for cytokinesis.
12852857 PLK1 phosphorylation of NudC plays an essential role in cytokinesis.
12852856 PLK1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12815053 Plk1 phosphorylates BRCA2 in M phase
12738781 a consensus motif for Plk (Polo-like kinase) phosphorylation is identified, and Myt1 is a Plk1 substrate
12732729 Depletion of this enzyme induces apoptosis in cancer cells
12708489 PLK1 overexpression was significantly associated with p53 accumulation in colorectal cancers. Our results suggest overexpression of PLK1 might be of pathogenic, prognostic and proliferative importance.
12595692 identified the polo-box domain (PBD) of the mitotic kinase polo-like kinase 1 as a specific phosphoserine or phosphothreonine binding domain and determined its optimal binding motif
12592388 Suppression of the activity of PLK1 via inhibition of tyrosine kinase activity by beta-HIVS might play a critical role in the induction of apoptosis.
12493754 interaction with Chk2 and localization to centrosomes and midbody
12447691 role in regulating subcellular localization of cyclin B1
12442251 A site corresponding to Ser326 in Plx1 was shown to be phosphorylated in the human polo-like kinase Plk1 (Ser335)
12429910 promoter elements responsible for transcriptional inhibition of polo-like kinase 1 and topoisomerase IIalpha genes by p21(WAF1/CIP1/SDI1)
12364337 accumulates in both the nucleus and the cytoplasm in addition to its localization to the centrosome during S and G(2) phases
12207013 Ser-137 may have an unexpected and novel role in the function of Plk
12147700 Plk1 kinase is involved in regulation of cyclin B1 phosphorylation and inhibited by ATR
12082631 Downregulation of cellular PLK1 levels in cancer cells altered cell cycle progression moderately with an elevated percentage (20-30%) of cells in G(2)/M. Furthermore, cells with reduced PLK1 protein gained a rounded phenotype with multiple centrosomes.
12077309 role of depletion in activating Cdc2/cyclin B and inhibition of centrosome amplification
12034729 both PB1 and PB2 regions are required for targeting the catalytic activity of Plk1 to centrosomes, midbody, and kinetochores
11931760 These results suggest that Polo-like kinase regulates the dissociation of cohesin from chromosomes early in mitosis. (cohesin)
11897663 results suggest that Plk1 phosphorylates Cdc25C on Ser198 and regulates nuclear translocation of Cdc25C during prophase
11854496 We have observed that overexpression of the C-terminal domain of Plk is more effective than wild-type or kinase-defective Plk in causing mitotic delay or arrest.

AA Sequence

MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEI      1 - 70
SDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLE     71 - 140
LHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKT    141 - 210
LCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAAS    211 - 280
LIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENP    281 - 350
LPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK    351 - 420
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHL    421 - 490
LKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFR    491 - 560
TYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS                               561 - 603
//

Text Mined References (498)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27102712 2016 Essential role for a novel population of binucleated mammary epithelial cells in lactation.
27002166 2016 MLL5 maintains spindle bipolarity by preventing aberrant cytosolic aggregation of PLK1.
26919439 2016 The Functional Significance of Posttranslational Modifications on Polo-Like Kinase 1 Revealed by Chemical Genetic Complementation.
26912231 2016 The Bub1-Plk1 kinase complex promotes spindle checkpoint signalling through Cdc20 phosphorylation.
26794530 2016 Cytotoxic mechanism of PLK1 inhibitor GSK461364 against osteosarcoma: Mitotic arrest, apoptosis, cellular senescence, and synergistic effect with paclitaxel.
26786872 2016 Functions of Polo-Like Kinases: A Journey From Yeast To Humans.
26647647 2015 PLK1 regulation of PCNT cleavage ensures fidelity of centriole separation during mitotic exit.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26608325 2015 Mumps Virus Nucleoprotein Enhances Phosphorylation of the Phosphoprotein by Polo-Like Kinase 1.
26595675 2015 Indirect p53-dependent transcriptional repression of Survivin, CDC25C, and PLK1 genes requires the cyclin-dependent kinase inhibitor p21/CDKN1A and CDE/CHR promoter sites binding the DREAM complex.
26576650 2015 FOXM1 and polo-like kinase 1 are co-ordinately overexpressed in patients with gastric adenocarcinomas.
26557691 2015 PLK-1 Targeted Inhibitors and Their Potential against Tumorigenesis.
26549165 2016 miR-296-5p suppresses cell viability by directly targeting PLK1 in non-small cell lung cancer.
26513691 2015 Selective blockade of cancer cell proliferation and anchorage-independent growth by Plk1 activity-dependent suicidal inhibition of its polo-box domain.
26503893 2015 PLK1 blockade enhances therapeutic effects of radiation by inducing cell cycle arrest at the mitotic phase.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26493360 2016 In silico identification of putative bifunctional Plk1 inhibitors by integrative virtual screening and structural dynamics approach.
26468278 2015 JNK-associated Leucine Zipper Protein Functions as a Docking Platform for Polo-like Kinase 1 and Regulation of the Associating Transcription Factor Forkhead Box Protein K1.
26406118 2015 A mitotic kinase scaffold depleted in testicular seminomas impacts spindle orientation in germ line stem cells.
26323689 2015 Usp16 regulates kinetochore localization of Plk1 to promote proper chromosome alignment in mitosis.
26318737 2015 High levels of polo-like kinase 1 and phosphorylated translationally controlled tumor protein indicate poor prognosis in neuroblastomas.
26317649 2015 Survival of primary, but not of cancer cells after combined Plk1-HDAC inhibition.
26293378 2015 Plk1 relieves centriole block to reduplication by promoting daughter centriole maturation.
26291670 2015 JIP4 is a PLK1 binding protein that regulates p38MAPK activity in G2 phase.
26259146 2015 The chromatin remodeller RSF1 is essential for PLK1 deposition and function at mitotic kinetochores.
26242183 2015 Plk1 regulates MEK1/2 and proliferation in airway smooth muscle cells.
26206521 2015 Spatiotemporal dynamics of Aurora B-PLK1-MCAK signaling axis orchestrates kinetochore bi-orientation and faithful chromosome segregation.
26192437 2015 PLK1-dependent activation of LRRK1 regulates spindle orientation by phosphorylating CDK5RAP2.
26171916 2015 Combined Immunohistochemistry of PLK1, p21, and p53 for Predicting TP53 Status: An Independent Prognostic Factor of Breast Cancer.
26124292 2015 Mio depletion links mTOR regulation to Aurora A and Plk1 activation at mitotic centrosomes.
26119734 2015 Plk1 and Mps1 Cooperatively Regulate the Spindle Assembly Checkpoint in Human Cells.
26090465 2015 The MicroRNA3686 Inhibits the Proliferation of Pancreas Carcinoma Cell Line by Targeting the Polo-Like Kinase 1.
26070557 2015 Polo-like Kinase 1 (Plk1) Up-regulates Telomerase Activity by Affecting Human Telomerase Reverse Transcriptase (hTERT) Stability.
26057687 2015 Regulation of NDR1 activity by PLK1 ensures proper spindle orientation in mitosis.
26047016 2015 Upregulated Polo-Like Kinase 1 Expression Correlates with Inferior Survival Outcomes in Rectal Cancer.
26012549 2015 Bimodal Interaction of Mammalian Polo-Like Kinase 1 and a Centrosomal Scaffold, Cep192, in the Regulation of Bipolar Spindle Formation.
25975351 2015 Differential Cellular Effects of Plk1 Inhibitors Targeting the ATP-binding Domain or Polo-box Domain.
25925375 2015 The Catalytic Subunit of DNA-Dependent Protein Kinase Coordinates with Polo-Like Kinase 1 to Facilitate Mitotic Entry.
25917079 2015 Eribulin synergizes with Polo-like kinase 1 inhibitors to induce apoptosis in rhabdomyosarcoma.
25855382 2015 PLK1 and HOTAIR Accelerate Proteasomal Degradation of SUZ12 and ZNF198 during Hepatitis B Virus-Induced Liver Carcinogenesis.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25830382 2015 Plk1 phosphorylation of IRS2 prevents premature mitotic exit via AKT inactivation.
25826089 2015 PLK1 is a critical determinant of tumor cell sensitivity to CPT11 and its inhibition enhances the drug antitumor efficacy in squamous cell carcinoma models sensitive and resistant to camptothecins.
25754767 2015 Prognostic significance of polo-like kinases in retinoblastoma: correlation with patient outcome, clinical and histopathological parameters.
25737075 2015 Sirt1 Regulates Microtubule Dynamics Through Negative Regulation of Plk1 in Mitosis.
25714006 2015 Identification of rictor as a novel substrate of Polo-like kinase 1.
25697066 2015 Therapeutic polo-like kinase 1 inhibition results in mitotic arrest and subsequent cell death of blasts in the bone marrow of AML patients and has similar effects in non-neoplastic cell lines.
25670858 2015 Mammalian Polo-like kinase 1 (Plk1) promotes proper chromosome segregation by phosphorylating and delocalizing the PBIP1·CENP-Q complex from kinetochores.
25666058 2015 Aurora B-dependent phosphorylation of Ataxin-10 promotes the interaction between Ataxin-10 and Plk1 in cytokinesis.
25659891 2015 Myotubularin-related proteins 3 and 4 interact with polo-like kinase 1 and centrosomal protein of 55 kDa to ensure proper abscission.
25607646 2015 Polo-like kinase 1 inhibits DNA damage response during mitosis.
25592872 2015 Misregulation of polo-like protein kinase 1, P53 and P21WAF1 in epithelial ovarian cancer suggests poor prognosis.
25565629 2015 Pharmacological inhibition of Polo-like kinase 1 (PLK1) by BI-2536 decreases the viability and survival of hamartin and tuberin deficient cells via induction of apoptosis and attenuation of autophagy.
25537513 2015 By promoting cell differentiation, miR-100 sensitizes basal-like breast cancer stem cells to hormonal therapy.
25524551 2015 Polo-like kinase 1 inhibitor BI2536 causes mitotic catastrophe following activation of the spindle assembly checkpoint in non-small cell lung cancer cells.
25505268 2015 PLK1 inhibition down-regulates polycomb group protein BMI1 via modulation of the miR-200c/141 cluster.
25505174 2015 Inhibition of polo-like kinase 1 (Plk1) enhances the antineoplastic activity of metformin in prostate cancer.
25504441 2015 The activity regulation of the mitotic centromere-associated kinesin by Polo-like kinase 1.
25503564 2015 Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.
25501367 2015 A unique insertion in STARD9's motor domain regulates its stability.
25486482 2014 Centralspindlin assembly and 2 phosphorylations on MgcRacGAP by Polo-like kinase 1 initiate Ect2 binding in early cytokinesis.
25483104 2015 Loss of p21Cip1/CDKN1A renders cancer cells susceptible to Polo-like kinase 1 inhibition.
25483079 2014 BRCA1 and FancJ cooperatively promote interstrand crosslinker induced centrosome amplification through the activation of polo-like kinase 1.
25480943 2015 Kinome-wide functional screen identifies role of PLK1 in hormone-independent, ER-positive breast cancer.
25430493 2015 Design, synthesis, and evaluation of non-ATP-competitive small-molecule Polo-like kinase 1 (Plk1) inhibitors.
25398439 2015 PLK1 phosphorylates PAX3-FOXO1, the inhibition of which triggers regression of alveolar Rhabdomyosarcoma.
25395579 2015 Chromosome congression is promoted by CENP-Q- and CENP-E-dependent pathways.
25347426 2015 The deregulated promoter methylation of the Polo-like kinases as a potential biomarker in hematological malignancies.
25347203 2015 A new class of peptidomimetics targeting the polo-box domain of Polo-like kinase 1.
25246616 2014 Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles.
25169932 2015 Mitotic arrest and slippage induced by pharmacological inhibition of Polo-like kinase 1.
25047839 2014 Plk1 phosphorylation of PTEN causes a tumor-promoting metabolic state.
25036634 2014 Polo-like kinase 1 licenses CENP-A deposition at centromeres.
24931513 2014 Polo-like kinase 1 regulates the stability of the mitotic centromere-associated kinesin in mitosis.
24893992 2014 Homeostatic control of polo-like kinase-1 engenders non-genetic heterogeneity in G2 checkpoint fidelity and timing.
24876664 2014 Expression of the microtubule-associated protein MAP9/ASAP and its partners AURKA and PLK1 in colorectal and breast cancers.
24874015 2014 Therapeutic targeting of Polo-like kinase-1 and Aurora kinases in T-cell acute lymphoblastic leukemia.
24844881 2014 Polo-like kinase 1 (PLK1) and protein phosphatase 6 (PP6) regulate DNA-dependent protein kinase catalytic subunit (DNA-PKcs) phosphorylation in mitosis.
24785407 2014 Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1?MYPT1 phosphatase complex and the SCF?TrCP E3 ubiquitin ligase.
24777477 2014 CLIP-170 recruits PLK1 to kinetochores during early mitosis for chromosome alignment.
24771642 2014 RNAi screen identifies a synthetic lethal interaction between PIM1 overexpression and PLK1 inhibition.
24767679 2014 A 3'UTR polymorphism modulates mRNA stability of the oncogene and drug target Polo-like Kinase 1.
24722282 2014 Liver kinase B1 regulates the centrosome via PLK1.
24706748 2014 Plk1 protein phosphorylates phosphatase and tensin homolog (PTEN) and regulates its mitotic activity during the cell cycle.
24626184 2014 The RNA helicase/transcriptional co-regulator, p68 (DDX5), stimulates expression of oncogenic protein kinase, Polo-like kinase-1 (PLK1), and is associated with elevated PLK1 levels in human breast cancers.
24519995 2014 PLK1 expression and BI 2536 effects in childhood acute lymphoblastic leukemia.
24501426 2014 Nek2 phosphorylates and stabilizes ?-catenin at mitotic centrosomes downstream of Plk1.
24498222 2014 p53-Dependent and cell specific epigenetic regulation of the polo-like kinases under oxidative stress.
24484936 2014 Sequential Cdk1 and Plk1 phosphorylation of caspase-8 triggers apoptotic cell death during mitosis.
24482237 2014 Phosphorylation of myosin II-interacting guanine nucleotide exchange factor (MyoGEF) at threonine 544 by aurora B kinase promotes the binding of polo-like kinase 1 to MyoGEF.
24451569 2014 Plk1 phosphorylates CLIP-170 and regulates its binding to microtubules for chromosome alignment.
24427308 2014 Sorcin links calcium signaling to vesicle trafficking, regulates Polo-like kinase 1 and is necessary for mitosis.
24413556 2014 Polo-like kinase-1 triggers histone phosphorylation by Haspin in mitosis.
24407358 2014 The function of FOXO1 in the late phases of the cell cycle is suppressed by PLK1-mediated phosphorylation.
24407240 2014 Association of p21 with NF-YA suppresses the expression of Polo-like kinase 1 and prevents mitotic death in response to DNA damage.
24349352 2013 NFBD1/MDC1 is phosphorylated by PLK1 and controls G2/M transition through the regulation of a TOPOII?-mediated decatenation checkpoint.
24338364 2014 Bora and Aurora-A continue to activate Plk1 in mitosis.
24327015 2014 An RNAi-based screen reveals PLK1, CDK1 and NDC80 as potential therapeutic targets in malignant pleural mesothelioma.
24271645 2013 In-silico screening of cancer associated mutation on PLK1 protein and its structural consequences.
24205328 2013 Polo-like kinase 1 (PLK1) is involved in toll-like receptor (TLR)-mediated TNF-? production in monocytic THP-1 cells.
24204733 2013 A high-content small molecule screen identifies sensitivity of glioblastoma stem cells to inhibition of polo-like kinase 1.
24196446 2014 Inhibition of endocytic vesicle fusion by Plk1-mediated phosphorylation of vimentin during mitosis.
24166892 2014 DNA-PKcs associates with PLK1 and is involved in proper chromosome segregation and cytokinesis.
24076372 2013 p53 Suppresses E2F1-dependent PLK1 expression upon DNA damage by forming p53-E2F1-DNA complex.
24067371 2013 CUL3 and protein kinases: insights from PLK1/KLHL22 interaction.
24067368 2013 BRCA1 downregulates the kinase activity of Polo-like kinase 1 in response to replication stress.
24032677 2013 Calmodulin activation of polo-like kinase 1 is required during mitotic entry.
24018379 2013 Centrosomal protein FOR20 is essential for S-phase progression by recruiting Plk1 to centrosomes.
23983103 2013 CIP2A modulates cell-cycle progression in human cancer cells by regulating the stability and activity of Plk1.
23977272 2013 Polo-like kinase 1 inhibits the activity of positive transcription elongation factor of RNA Pol II b (P-TEFb).
23887393 2013 PDK1 signaling toward PLK1-MYC activation confers oncogenic transformation, tumor-initiating cell activation, and resistance to mTOR-targeted therapy.
23804033 2013 Kindlin-1 regulates mitotic spindle formation by interacting with integrins and Plk-1.
23792639 2013 In vitro targeting of Polo-like kinase 1 in bladder carcinoma: comparative effects of four potent inhibitors.
23790466 2013 Inhibition of polo-like kinase 1 in glioblastoma multiforme induces mitotic catastrophe and enhances radiosensitisation.
23770244 2013 PLK1 signaling in breast cancer cells cooperates with estrogen receptor-dependent gene transcription.
23757039 2013 PLK1 and YY1 interaction in follicular lymphoma is associated with unfavourable outcome.
23753023 2013 Inhibiting Polo-like kinase 1 causes growth reduction and apoptosis in pediatric acute lymphoblastic leukemia cells.
23750008 2013 The role of PLK1-phosphorylated SVIL in myosin II activation and cytokinetic furrowing.
23713868 2013 Inhibition of polo-like kinase 1 induces cell cycle arrest and sensitizes glioblastoma cells to ionizing radiation.
23695676 2013 PI 3-kinase-dependent phosphorylation of Plk1-Ser99 promotes association with 14-3-3? and is required for metaphase-anaphase transition.
23661607 2013 Plk1-dependent microtubule dynamics promotes androgen receptor signaling in prostate cancer.
23643811 2013 APC/C(Cdh1)-dependent degradation of Cdc20 requires a phosphorylation on CRY-box by Polo-like kinase-1 during somatic cell cycle.
23615397 2013 Cardiac glycosides block cancer growth through HIF-1?- and NF-?B-mediated Plk1.
23574746 2013 Polo-like kinase 1 inhibitors, mitotic stress and the tumor suppressor p53.
23566315 2013 Targeting mutant KRAS for anticancer therapeutics: a review of novel small molecule modulators.
23525475 2013 Downregulation of Polo-like kinase 1 induces cellular senescence in human primary cells through a p53-dependent pathway.
23520509 2013 The Polo-Like Kinase 1 (PLK1) inhibitor NMS-P937 is effective in a new model of disseminated primary CD56+ acute monoblastic leukaemia.
23509069 2013 MISP is a novel Plk1 substrate required for proper spindle orientation and mitotic progression.
23494182 2013 Polo-like kinase 1 is overexpressed in renal cancer and participates in the proliferation and invasion of renal cancer cells.
23455478 2013 Ubiquitylation-dependent localization of PLK1 in mitosis.
23455152 2013 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.
23359173 2013 The expression of Nek7, FoxM1, and Plk1 in gallbladder cancer and their relationships to clinicopathologic features and survival.
23345402 2013 PCM1 recruits Plk1 to the pericentriolar matrix to promote primary cilia disassembly before mitotic entry.
23188630 2013 Plk1 phosphorylation of orc2 and hbo1 contributes to gemcitabine resistance in pancreatic cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23151088 2012 MicroRNA-100 is a potential molecular marker of non-small cell lung cancer and functions as a tumor suppressor by targeting polo-like kinase 1.
23144294 2013 Polo-like kinase 1: a potential therapeutic option in combination with conventional chemotherapy for the management of patients with triple-negative breast cancer.
23105120 2012 High mitotic activity of Polo-like kinase 1 is required for chromosome segregation and genomic integrity in human epithelial cells.
23079597 2012 Integration of kinase and phosphatase activities by BUBR1 ensures formation of stable kinetochore-microtubule attachments.
23063527 2012 Gravin is a transitory effector of polo-like kinase 1 during cell division.
23046929 2012 [Effect of Plk1 330/597 serine phosphorylated mutant on cytokinesis during mitosis].
23045552 2012 Cdk1 and Plk1 mediate a CLASP2 phospho-switch that stabilizes kinetochore-microtubule attachments.
23037713 2012 The FOXM1-PLK1 axis is commonly upregulated in oesophageal adenocarcinoma.
22918237 2012 4E-BP1 participates in maintaining spindle integrity and genomic stability via interacting with PLK1.
22908307 2012 Polo-like kinase-1 regulates kinetochore-microtubule dynamics and spindle checkpoint silencing.
22892842 2012 Validation of Polo-like kinase 1 as a therapeutic target in pancreatic cancer cells.
22890325 2013 Plk1 is upregulated in androgen-insensitive prostate cancer cells and its inhibition leads to necroptosis.
22869522 2012 Plk1 phosphorylates Sgt1 at the kinetochores to promote timely kinetochore-microtubule attachment.
22863584 2012 [Screening and identification of Polo-like kinase 1 as a 14-3-3Zeta-interacting protein].
22854038 2012 Polo-like kinase is required for synaptonemal complex disassembly and phosphorylation in mouse spermatocytes.
22826617 2012 Polo-like kinase 1, a new therapeutic target in hepatocellular carcinoma.
22820163 2012 Phosphorylation of Tara by Plk1 is essential for faithful chromosome segregation in mitosis.
22818914 2012 Nek9 phosphorylation of NEDD1/GCP-WD contributes to Plk1 control of ?-tubulin recruitment to the mitotic centrosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22795848 2012 In vivo tumor imaging using polo-box domain of polo-like kinase 1 targeted peptide.
22753416 2012 Furry protein promotes aurora A-mediated Polo-like kinase 1 activation.
22753241 2012 Proliferation state and polo-like kinase1 dependence of tumorigenic colon cancer cells.
22701722 2012 The centrosomal kinase Plk1 localizes to the transition zone of primary cilia and induces phosphorylation of nephrocystin-1.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
22648245 2012 Polo-like kinase 1 is overexpressed in colorectal cancer and participates in the migration and invasion of colorectal cancer cells.
22641346 2012 LATS1/WARTS phosphorylates MYPT1 to counteract PLK1 and regulate mammalian mitotic progression.
22621898 2012 Plk1 negatively regulates PRC1 to prevent premature midzone formation before cytokinesis.
22609948 2012 Identification of a novel Wnt5a-CK1?-Dvl2-Plk1-mediated primary cilia disassembly pathway.
22593191 2012 Numb regulates stability and localization of the mitotic kinase PLK1 and is required for transit through mitosis.
22566210 2012 A stringent requirement for Plk1 T210 phosphorylation during K-fiber assembly and chromosome congression.
22535524 2012 Plk1 regulates the kinesin-13 protein Kif2b to promote faithful chromosome segregation.
22467873 2012 G protein-coupled receptor kinase 5 phosphorylates nucleophosmin and regulates cell sensitivity to polo-like kinase 1 inhibition.
22427657 2012 Involvement of polo-like kinase 1 (Plk1) in mitotic arrest by inhibition of mitogen-activated protein kinase-extracellular signal-regulated kinase-ribosomal S6 kinase 1 (MEK-ERK-RSK1) cascade.
22405092 2012 Immunohistochemical detection of Polo-like kinase-1 (PLK1) in primary breast cancer is associated with TP53 mutation and poor clinical outcom.
22391203 2012 HIV-1 Tat impairs cell cycle control by targeting the Tip60, Plk1 and cyclin B1 ternary complex.
22390279 2012 Polo-like kinase 1 (PLK1) inhibition suppresses cell growth and enhances radiation sensitivity in medulloblastoma cells.
22365832 2012 Plk1-dependent phosphorylation of optineurin provides a negative feedback mechanism for mitotic progression.
22325354 2012 Plk1 and CK2 act in concert to regulate Rad51 during DNA double strand break repair.
22314839 2012 Study on the effect of IRE1a on cell growth and apoptosis via modulation PLK1 in ER stress response.
22309939 2012 Small interfering RNA library screen identified polo-like kinase-1 (PLK1) as a potential therapeutic target for breast cancer that uniquely eliminates tumor-initiating cells.
22281053 2012 Direct regulation of tRNA and 5S rRNA gene transcription by Polo-like kinase 1.
22262171 2012  p53 is not directly relevant to the response of Polo-like kinase 1 inhibitors.
22249248 2012 Sequential analysis of multistage hepatocarcinogenesis reveals that miR-100 and PLK1 dysregulation is an early event maintained along tumor progression.
22192978 2013 High expression of polo-like kinase 1 is associated with the metastasis and recurrence in urothelial carcinoma of bladder.
22188812 2012 TAK-960, a novel, orally available, selective inhibitor of polo-like kinase 1, shows broad-spectrum preclinical antitumor activity in multiple dosing regimens.
22184200 2011 PLK1 phosphorylation of pericentrin initiates centrosome maturation at the onset of mitosis.
22184120 2012 Centrosomal protein 55 (Cep55) stability is negatively regulated by p53 protein through Polo-like kinase 1 (Plk1).
22154349 2012 5-(2-amino-pyrimidin-4-yl)-1H-pyrrole and 2-(2-amino-pyrimidin-4-yl)-1,5,6,7-tetrahydro-pyrrolo[3,2-c]pyridin-4-one derivatives as new classes of selective and orally available Polo-like kinase 1 inhibitors.
22120675 2012 MiR-100 resensitizes docetaxel-resistant human lung adenocarcinoma cells (SPC-A1) to docetaxel by targeting Plk1.
22115795 2012 Inhibition of Plk1 and Pin1 by 5'-nitro-indirubinoxime suppresses human lung cancer cells.
22108192 2012 Reciprocal activation between PLK1 and Stat3 contributes to survival and proliferation of esophageal cancer cells.
22064247 2012 Overexpression of polo-like kinase 1 and its clinical significance in human non-small cell lung cancer.
22000864 2012 Clinicopathological significance of Polo-like kinase 1 (PLK1) expression in human malignant glioma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21987589 2011 Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.
21978935 2011 Cooperative phosphorylation of FADD by Aur-A and Plk1 in response to taxol triggers both apoptotic and necrotic cell death.
21953073 2011 Inhibition of Polo-like kinase 1 prevents the growth of metastatic breast cancer cells in the brain.
21947279 2011 Plk1 phosphorylation of Orc2 promotes DNA replication under conditions of stress.
21890624 2011 Polo-like kinase 1 facilitates loss of Pten tumor suppressor-induced prostate cancer formation.
21887822 2011 Proteomic identification of Hsp70 as a new Plk1 substrate in arsenic trioxide-induced mitotically arrested cells.
21880710 2011 Phosphorylation of right open reading frame 2 (Rio2) protein kinase by polo-like kinase 1 regulates mitotic progression.
21857149 2011 Phosphorylation of Ataxin-10 by polo-like kinase 1 is required for cytokinesis.
21857030 2011 Quantitative phospho-proteomics to investigate the polo-like kinase 1-dependent phospho-proteome.
21818122 2012 Tankyrase-1 function at telomeres and during mitosis is regulated by Polo-like kinase-1-mediated phosphorylation.
21816470 2011 Expression, adverse prognostic significance and therapeutic small molecule inhibition of Polo-like kinase 1 in multiple myeloma.
21813642 2011 Phosphorylation of Ran-binding protein-1 by Polo-like kinase-1 is required for interaction with Ran and early mitotic progression.
21768102 2011 The auto-ubiquitylation of E3 ubiquitin-protein ligase Chfr at G2 phase is required for accumulation of polo-like kinase 1 and mitotic entry in mammalian cells.
21750699 2011 Microenvironmental influence on pre-clinical activity of polo-like kinase inhibition in multiple myeloma: implications for clinical translation.
21726628 2011 Suppression of Polo like kinase 1 (PLK1) by p21(Waf1) mediates the p53-dependent prevention of caspase-independent mitotic death.
21723128 2011 Plk1 controls the Nek2A-PP1? antagonism in centrosome disjunction.
21690413 2011 Regulation of microtubule-based microtubule nucleation by mammalian polo-like kinase 1.
21642957 2011 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
21640712 2011 Study of the docking-dependent PLK1 phosphorylation of the CDC25B phosphatase.
21636267 2011 Reduced miR-100 expression in cervical cancer and precursors and its carcinogenic effect through targeting PLK1 protein.
21635870 2011 Plk1 is negatively regulated by RNF8.
21610149 2011 PLK1 Is transcriptionally activated by NF-?B during cell detachment and enhances anoikis resistance through inhibiting ?-catenin degradation in esophageal squamous cell carcinoma.
21602893 2011 Integrative mRNA profiling comparing cultured primary cells with clinical samples reveals PLK1 and C20orf20 as therapeutic targets in cutaneous squamous cell carcinoma.
21576470 2011 Continuous polo-like kinase 1 activity regulates diffusion to maintain centrosome self-organization during mitosis.
21533207 2011 Quantitative mass spectrometry analysis reveals similar substrate consensus motif for human Mps1 kinase and Plk1.
21522128 2011 Differential control of Eg5-dependent centrosome separation by Plk1 and Cdk1.
21519187 2011 Regulation of the final stage of mitosis by components of the pre-replicative complex and a polo kinase.
21507953 2011 Polo-like kinase1 is required for recruitment of dynein to kinetochores during mitosis.
21480320 2011 Proteins ZNF198 and SUZ12 are down-regulated in hepatitis B virus (HBV) X protein-mediated hepatocyte transformation and in HBV replication.
21474997 2011 Polo-like kinase 1 regulates activation of AMP-activated protein kinase (AMPK) at the mitotic apparatus.
21454580 2011 Mammalian polo-like kinase 1-dependent regulation of the PBIP1-CENP-Q complex at kinetochores.
21436619 2011 Polo-like kinase 1 (Plk1) is expressed by cutaneous T-cell lymphomas (CTCLs), and its downregulation promotes cell cycle arrest and apoptosis.
21402792 2011 The astrin-kinastrin/SKAP complex localizes to microtubule plus ends and facilitates chromosome alignment.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21399492 2011 Inhibition of polo-like kinase 1 leads to the suppression of osteosarcoma cell growth in vitro and in vivo.
21330050 2011 Polo-like kinase 1 contributes to the tumorigenicity of BEL-7402 hepatoma cells via regulation of Survivin expression.
21271384 2011 [Influence of silencing Polo-like kinase 1 on migration and invasion of colorectal cancer cells].
21269460 2011 Initial characterization of the human central proteome.
21253604 2011 The transcription factor YY1 is a substrate for Polo-like kinase 1 at the G2/M transition of the cell cycle.
21242189 2011 Polo-like kinase-1 as a novel target in neoplastic mast cells: demonstration of growth-inhibitory effects of small interfering RNA and the Polo-like kinase-1 targeting drug BI 2536.
21184800 2011 The polo-like kinase inhibitor BI 2536 exhibits potent activity against malignant plasma cells and represents a novel therapy in multiple myeloma.
21170987 2011 Polo-like kinase 1 regulates cell proliferation and is targeted by miR-593* in esophageal cancer.
21169242 2011 Polo-like kinase 1 is a therapeutic target in high-risk neuroblastoma.
21148584 2011 Aurora B kinase activation requires survivin priming phosphorylation by PLK1.
21111234 2010 Sororin mediates sister chromatid cohesion by antagonizing Wapl.
21079244 2010 Plk1 negatively regulates Cep55 recruitment to the midbody to ensure orderly abscission.
21078677 2011 PLK1 phosphorylates mitotic centromere-associated kinesin and promotes its depolymerase activity.
21051833 2010 [Expression of checkpoint kinase 1 and polo-like kinase 1 and its clinicopathological significance in benign and malignant lesions of the stomach].
21041660 2010 Cell division cycle 6, a mitotic substrate of polo-like kinase 1, regulates chromosomal segregation mediated by cyclin-dependent kinase 1 and separase.
20962589 2010 p53-dependent repression of polo-like kinase-1 (PLK1).
20937827 2010 Mitotic inhibition of GRASP65 organelle tethering involves Polo-like kinase 1 (PLK1) phosphorylation proximate to an internal PDZ ligand.
20890306 2011 Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD.
20869364 2010 Purification and proteomic identification of putative upstream regulators of polo-like kinase-1 from mitotic cell extracts.
20860994 2011 The Plk1-dependent phosphoproteome of the early mitotic spindle.
20823832 2010 Dishevelled, a Wnt signalling component, is involved in mitotic progression in cooperation with Plk1.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20679239 2010 Polo-like kinase 1 phosphorylation of p150Glued facilitates nuclear envelope breakdown during prophase.
20671765 2010 Multifaceted polo-like kinases: drug targets and antitargets for cancer therapy.
20664522 2010 Phosphorylation of CLIP-170 by Plk1 and CK2 promotes timely formation of kinetochore-microtubule attachments.
20656208 2010 Centriole reduplication during prolonged interphase requires procentriole maturation governed by Plk1.
20624918 2010 Polo-like kinase 1 activated by the hepatitis B virus X protein attenuates both the DNA damage checkpoint and DNA repair resulting in partial polyploidy.
20622363 Expression profiling of G2/M phase regulatory proteins in normal, premalignant and malignant uterine cervix and their correlation with survival of patients.
20615875 2010 Plk1 regulates both ASAP localization and its role in spindle pole integrity.
20581453 2010 Mitotic DNA damage response: Polo-like kinase-1 is dephosphorylated through ATM-Chk1 pathway.
20581060 2010 Polo-like kinase 1 as predictive marker and therapeutic target for radiotherapy in rectal cancer.
20577264 2010 Polo-like kinase 1 phosphorylation of G2 and S-phase-expressed 1 protein is essential for p53 inactivation during G2 checkpoint recovery.
20573420 2010 Plk1-mediated mitotic phosphorylation of PinX1 regulates its stability.
20534861 2010 Polo-like kinase 1 is involved in hepatitis C virus replication by hyperphosphorylating NS5A.
20511645 2010 Centrobin/NIP2 is a microtubule stabilizer whose activity is enhanced by PLK1 phosphorylation during mitosis.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20484576 2010 The scaffold protein TANK/I-TRAF inhibits NF-kappaB activation by recruiting polo-like kinase 1.
20470222 2010 Polo-like kinase 1 is essential to DNA damage recovery.
20427271 2010 Liaisons between survivin and Plk1 during cell division and cell death.
20404504 2010 A functional link between polo-like kinase 1 and the mammalian target-of-rapamycin pathway?
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20198330 2010 The antitumor effect of PLK1 and HSF1 double knockdown on human oral carcinoma cells.
20170163 2010 Identification of 2-anilino-9-methoxy-5,7-dihydro-6H-pyrimido[5,4-d][1]benzazepin-6-ones as dual PLK1/VEGF-R2 kinase inhibitor chemotypes by structure-based lead generation.
20146883 Real-time fluorescent quantitative polymerase chain reaction study of polo-like kinase-1 in pterygia.
20145140 2010 Polo-like kinase 1 (Plk1) as a novel drug target in chronic myeloid leukemia: overriding imatinib resistance with the Plk1 inhibitor BI 2536.
20130082 2010 PICH and cotargeted Plk1 coordinately maintain prometaphase chromosome arm architecture.
20103597 2010 A fine-needle aspirate-based vulnerability assay identifies polo-like kinase 1 as a mediator of gemcitabine resistance in pancreatic cancer.
20089605 2010 Polo-like kinase 1 enhances survival and mutagenesis after genotoxic stress in normal cells through cell cycle checkpoint bypass.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19855194 2009 DH166, a beta-carboline derivative, inhibits the kinase activity of PLK1.
19833129 2009 Polo-like kinase-1 phosphorylates MDM2 at Ser260 and stimulates MDM2-mediated p53 turnover.
19822658 2009 Cyclin A2-cyclin-dependent kinase 2 cooperates with the PLK1-SCFbeta-TrCP1-EMI1-anaphase-promoting complex/cyclosome axis to promote genome reduplication in the absence of mitosis.
19821153 2010 Plk1 phosphorylation of Topors is involved in its degradation.
19804365 2009 Cancer Osaka thyroid (Cot) phosphorylates Polo-like kinase (PLK1) at Ser137 but not at Thr210.
19775446 2009 The expression of PLK-1 in cervical carcinoma: a possible target for enhancing chemosensitivity.
19758559 2009 Polo kinase and separase regulate the mitotic licensing of centriole duplication in human cells.
19739117 2010 Significance of Plk1 regulation by miR-100 in human nasopharyngeal cancer.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19725153 2009 Overexpression of polo-like kinase1 predicts a poor prognosis in hepatocellular carcinoma patients.
19706541 2009 Polo-like kinases mediate cell survival in mitochondrial dysfunction.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690138 2009 Distinct concentration-dependent effects of the polo-like kinase 1-specific inhibitor GSK461364A, including differential effect on apoptosis.
19668228 2009 Plk1 regulates liver tumor cell death by phosphorylation of TAp63.
19631697 2009 Identification of a nuclear localization signal in the polo box domain of Plk1.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19597481 2009 Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
19572149 2010 Overexpression of Plk1 promotes malignant progress in human esophageal squamous cell carcinoma.
19554017 2009 Targeted depletion of Polo-like kinase (Plk) 1 through lentiviral shRNA or a small-molecule inhibitor causes mitotic catastrophe and induction of apoptosis in human melanoma cells.
19546225 2009 Polo-like kinase 1 (PLK1) regulates interferon (IFN) induction by MAVS.
19543530 2009 Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components.
19509060 2009 Sequential phosphorylation of Nedd1 by Cdk1 and Plk1 is required for targeting of the gammaTuRC to the centrosome.
19503101 2009 BubR1 localizes to centrosomes and suppresses centrosome amplification via regulating Plk1 activity in interphase cells.
19487276 2009 Aurora-A and hBora join the game of Polo.
19473992 2009 Plk1-mediated phosphorylation of Topors regulates p53 stability.
19468302 2009 Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
19468300 2009 Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation.
19458358 2009 Polo-like kinase 1 is overexpressed in acute myeloid leukemia and its inhibition preferentially targets the proliferation of leukemic cells.
19452252 2009 Absence of tumor-specific over-expression of Polo-like kinase 1 (Plk1) in major non-Hodgkin lymphoma and relatively low expression of Plk1 in nasal NK/T cell lymphoma.
19400994 2009 Association of spindle midzone particles with polo-like kinase 1 during meiosis in mouse and human oocytes.
19386263 2009 Plk1-dependent and -independent roles of an ODF2 splice variant, hCenexin1, at the centrosome of somatic cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19351716 2009 Plk1 and Aurora A regulate the depolymerase activity and the cellular localization of Kif2a.
19289504 2009 Polo-like kinase 1 depletion induces DNA damage in early S prior to caspase activation.
19177004 2009 Long-term downregulation of Polo-like kinase 1 increases the cyclin-dependent kinase inhibitor p21(WAF1/CIP1).
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19160488 2008 Plk1-dependent phosphorylation of FoxM1 regulates a transcriptional programme required for mitotic progression.
19152411 2009 Interaction between human papillomavirus type 5 E2 and polo-like kinase 1.
19033445 2009 Deficiency in chromosome congression by the inhibition of Plk1 polo box domain-dependent recognition.
19029337 2008 FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
19004025 2009 Overexpression of PLK1 is associated with poor survival by inhibiting apoptosis via enhancement of survivin level in esophageal squamous cell carcinoma.
18980975 2008 Aberrant Polo-like kinase 1-Cdc25A pathway in metastatic hepatocellular carcinoma.
18957422 2008 Regulation of I(kappa)B kinase complex by phosphorylation of (gamma)-binding domain of I(kappa)B kinase (beta) by Polo-like kinase 1.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18922800 2008 Requirements for protein phosphorylation and the kinase activity of polo-like kinase 1 (Plk1) for the kinetochore function of mitotic arrest deficiency protein 1 (Mad1).
18820703 2009 Polo-like kinase 1 phosphorylates and regulates Bcl-x(L) during pironetin-induced apoptosis.
18695677 2008 Phosphorylation of Plk1 at Ser326 regulates its functions during mitotic progression.
18694934 2008 Phosphorylation of MyoGEF on Thr-574 by Plk1 promotes MyoGEF localization to the central spindle.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18662541 2008 The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint.
18625707 2008 Plk1 phosphorylation of TRF1 is essential for its binding to telomeres.
18616938 2008 Evaluation of Polo-like Kinase 1 inhibition on the G2/M checkpoint in Acute Myelocytic Leukaemia.
18615013 2008 Polo-like kinase-1 is activated by aurora A to promote checkpoint recovery.
18566290 2008 Bora and the kinase Aurora a cooperatively activate the kinase Plk1 and control mitotic entry.
18560274 2008 Functional independency between catalytic activity and subcellular targeting of polo-like kinase-1: phenotypes of ectopic overexpression of various mutants.
18547964 2008 Polo-like kinase 1 as a new target for non-Hodgkin's lymphoma treatment.
18521620 2008 Plk1 regulates mitotic Aurora A function through betaTrCP-dependent degradation of hBora.
18477460 2008 Myosin phosphatase-targeting subunit 1 regulates mitosis by antagonizing polo-like kinase 1.
18427546 2008 P21-activated kinase is required for mitotic progression and regulates Plk1.
18418051 2008 p73-mediated transcriptional activity is negatively regulated by polo-like kinase 1.
18391401 2008 Structure of wild-type Plk-1 kinase domain in complex with a selective DARPin.
18378770 2008 Plk1- and beta-TrCP-dependent degradation of Bora controls mitotic progression.
18353325 2009 High expression levels of cyclin B1 and Polo-like kinase 1 in ectopic endometrial cells associated with abnormal cell cycle regulation of endometriosis.
18331714 2008 sSgo1, a major splice variant of Sgo1, functions in centriole cohesion where it is regulated by Plk1.
18329369 2008 Final stages of cytokinesis and midbody ring formation are controlled by BRUCE.
18298903 2008 Expression of PLK1 and survivin in non-Hodgkin's lymphoma treated with CHOP.
18298087 2008 Plk1 activation by Ste20-like kinase (Slk) phosphorylation and polo-box phosphopeptide binding assayed with the substrate translationally controlled tumor protein (TCTP).
18297112 2008 Plk1 depletion in nontransformed diploid cells activates the DNA-damage checkpoint.
18278450 2008 Effect of antisense RNA targeting Polo-like kinase 1 on cell growth in A549 lung cancer cells.
18250300 2008 Role for Plk1 phosphorylation of Hbo1 in regulation of replication licensing.
18195732 2008 Cyclin B1 is localized to unattached kinetochores and contributes to efficient microtubule attachment and proper chromosome alignment during mitosis.
18174154 2008 Inhibitory role of Plk1 in the regulation of p73-dependent apoptosis through physical interaction and phosphorylation.
18171681 2008 Plk1-dependent phosphorylation regulates functions of DNA topoisomerase IIalpha in cell cycle progression.
18062778 2008 Plk3 phosphorylates topoisomerase IIalpha at Thr(1342), a site that is not recognized by Plk1.
18056432 2007 Polo-like kinase 1 is involved in invasion through extracellular matrix.
18005335 2007 Selectivity-determining residues in Plk1.
17981789 2007 A cell proliferation and chromosomal instability signature in anaplastic thyroid carcinoma.
17943598 2007 Expression of PLK1 and survivin in diffuse large B-cell lymphoma.
17671160 2007 Use of the novel Plk1 inhibitor ZK-thiazolidinone to elucidate functions of Plk1 in early and late stages of mitosis.
17635521 2007 Polo-like kinase 1 regulates RhoA during cytokinesis exit in human cells.
17623655 2007 Phospho-regulation of HsCdc14A By Polo-like kinase 1 is essential for mitotic progression.
17617734 2007 Shugoshin 1 plays a central role in kinetochore assembly and is required for kinetochore targeting of Plk1.
17610829 2007 Cell cycle: on-time delivery of Plk1 during cytokinesis.
17495026 2007 The tumor suppressor CYLD regulates entry into mitosis.
17488623 2007 Polo-like kinase 1 triggers the initiation of cytokinesis in human cells by promoting recruitment of the RhoGEF Ect2 to the central spindle.
17476331 2007 Polo-like kinase controls vertebrate spindle elongation and cytokinesis.
17461553 2007 Structure of the catalytic domain of human polo-like kinase 1.
17446864 2007 Proteomic screen defines the Polo-box domain interactome and identifies Rock2 as a Plk1 substrate.
17434144 2007 siRNA targeting PLK-1 induces apoptosis of synoviocytes in rheumatoid arthritis.
17376779 2007 Polo-like kinase 1 facilitates chromosome alignment during prometaphase through BubR1.
17360533 2007 Chemical genetics reveals the requirement for Polo-like kinase 1 activity in positioning RhoA and triggering cytokinesis in human cells.
17359284 2007 Nuclear cyclin B1 in human breast carcinoma as a potent prognostic factor.
17351902 2007 RNAse A-like enzymes in serum inhibit the anti-neoplastic activity of siRNA targeting polo-like kinase 1.
17351640 2007 Choice of Plk1 docking partners during mitosis and cytokinesis is controlled by the activation state of Cdk1.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17310276 2007 TTDN1 is a Plk1-interacting protein involved in maintenance of cell cycle integrity.
17307877 2007 Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization.
17265445 2007 Overexpression of cyclooxygenase-2 in human prostate carcinoma and prostatic intraepithelial neoplasia-association with increased expression of Polo-like kinase-1.
17253180 2007 [Polo like kinase 1 expression and prognostic value in gastric carcinomas].
17218258 2007 PICH, a centromere-associated SNF2 family ATPase, is regulated by Plk1 and required for the spindle checkpoint.
17146433 2007 RGC32, a novel p53-inducible gene, is located on centrosomes during mitosis and results in G2/M arrest.
17121863 2007 Regulation of Polo-like kinase 1 by DNA damage in mitosis. Inhibition of mitotic PLK-1 by protein phosphatase 2A.
17121839 2007 Nitric oxide down-regulates polo-like kinase 1 through a proximal promoter cell cycle gene homology region.
17102638 2006 Ectopic expression of Plk1 leads to activation of the spindle checkpoint.
17081991 2006 Self-regulated Plk1 recruitment to kinetochores by the Plk1-PBIP1 interaction is critical for proper chromosome segregation.
17005603 2007 Osteopontin localizes to the nucleus of 293 cells and associates with polo-like kinase-1.
16980960 2006 The Plk1 target Kizuna stabilizes mitotic centrosomes to ensure spindle bipolarity.
16966375 2006 Requirement of hCenexin for proper mitotic functions of polo-like kinase 1 at the centrosomes.
16934469 2006 Polo-like kinase-1 controls proteasome-dependent degradation of Claspin during checkpoint recovery.
16930555 2006 Polo-like kinase 1-mediated phosphorylation of the GTP-binding protein Ran is important for bipolar spindle formation.
16927022 2006 Influence of chk1 and plk1 silencing on radiation- or cisplatin-induced cytotoxicity in human malignant cells.
16885022 2006 SCFbetaTrCP-mediated degradation of Claspin regulates recovery from the DNA replication checkpoint response.
16873548 2006 Checkpoint kinase 1 (Chk1) is required for mitotic progression through negative regulation of polo-like kinase 1 (Plk1).
16865274 2006 Oncogenic effect of Polo-like kinase 1 expression in human gastric carcinomas.
16860740 2006 NudC is required for Plk1 targeting to the kinetochore and chromosome congression.
16837776 2006 Overexpression of polo-like kinase 1 (PLK1) and chromosomal instability in bladder cancer.
16760428 2006 Phosphorylation- and polo-box-dependent binding of Plk1 to Bub1 is required for the kinetochore localization of Plk1.
16753148 2006 Polo-like kinase 1 regulates mitotic arrest after UV irradiation through dephosphorylation of p53 and inducing p53 degradation.
16648550 2006 Molecular alterations after Polo-like kinase 1 mRNA suppression versus pharmacologic inhibition in cancer cells.
16645325 2006 Expression of polo-like kinase 1 (PLK1) protein predicts the survival of patients with gastric carcinoma.
16630118 2006 Expression patterns of polo-like kinase 1 in human gastric cancer.
16582488 2006 Crystallization and preliminary X-ray diffraction studies on the human Plk1 Polo-box domain in complex with an unphosphorylated and a phosphorylated target peptide from Cdc25C.
16478733 2006 Polo box domain of Plk3 functions as a centrosome localization signal, overexpression of which causes mitotic arrest, cytokinesis defects, and apoptosis.
16469711 2006 [Knockdown of PLK1 mRNA by special siRNA].
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16439210 2006 The evi5 oncogene regulates cyclin accumulation by stabilizing the anaphase-promoting complex inhibitor emi1.
16378098 2006 Complex formation of Plk1 and INCENP required for metaphase-anaphase transition.
16267267 2006 Different Plk1 functions show distinct dependencies on Polo-Box domain-mediated targeting.
16260496 2005 Phosphorylation by Cdk1 induces Plk1-mediated vimentin phosphorylation during mitosis.
16254247 2005 Phosphorylation of Nlp by Plk1 negatively regulates its dynein-dynactin-dependent targeting to the centrosome.
16247472 2006 Phosphorylation of the cytokinesis regulator ECT2 at G2/M phase stimulates association of the mitotic kinase Plk1 and accumulation of GTP-bound RhoA.
16237758 2005 Polo-like kinase 1 expression is a prognostic factor in human colon cancer.
16198290 2005 Cdk1/Erk2- and Plk1-dependent phosphorylation of a centrosome protein, Cep55, is required for its recruitment to midbody and cytokinesis.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16157594 2005 The role of Polo-like kinase 1 in the inhibition of centrosome separation after ionizing radiation.
16127294 2005 Polo-like kinase 1 expression in medullary carcinoma of the thyroid: its relationship with clinicopathological features.
15923617 2005 CCT chaperonin complex is required for the biogenesis of functional Plk1.
15876876 2005 The Plk1 Polo box domain mediates a cell cycle and DNA damage regulated interaction with Chk2.
15855824 2005 Overexpression of Polo-like kinase 1 is a common and early event in pancreatic cancer.
15713655 2005 Uncoupling anaphase-promoting complex/cyclosome activity from spindle assembly checkpoint control by deregulating polo-like kinase 1.
15678101 2005 Plk1 docking to GRASP65 phosphorylated by Cdk1 suggests a mechanism for Golgi checkpoint signalling.
15664519 2005 Wortmannin, a widely used phosphoinositide 3-kinase inhibitor, also potently inhibits mammalian polo-like kinase.
15661849 2005 Silencing of polo-like kinase (Plk) 1 via siRNA causes induction of apoptosis and impairment of mitosis machinery in human prostate cancer cells: implications for the treatment of prostate cancer.
15661742 2005 Polo-like kinase 1 phosphorylates heat shock transcription factor 1 and mediates its nuclear translocation during heat stress.
15654075 2005 Interaction of chromatin-associated Plk1 and Mcm7.
15616186 2005 The forkhead-associated domain protein Cep170 interacts with Polo-like kinase 1 and serves as a marker for mature centrioles.
15611664 2005 Phosphorylation of Plk1 at S137 and T210 is inhibited in response to DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469984 2004 Plk1 regulates activation of the anaphase promoting complex by phosphorylating and triggering SCFbetaTrCP-dependent destruction of the APC Inhibitor Emi1.
15458642 2004 Roles of polo-like kinase 1 in the assembly of functional mitotic spindles.
15350223 2004 Polo-like kinase-1 controls recovery from a G2 DNA damage-induced arrest in mammalian cells.
15280449 2004 Polo-like kinase 1 inactivation following mitotic DNA damaging treatments is independent of ataxia telangiectasia mutated kinase.
15210710 2004 Polo-like kinase-1 is required for bipolar spindle formation but is dispensable for anaphase promoting complex/Cdc20 activation and initiation of cytokinesis.
15199097 2004 Molecular interactions of Polo-like-kinase 1 with the mitotic kinesin-like protein CHO1/MKLP-1.
15190079 2004 B23/nucleophosmin serine 4 phosphorylation mediates mitotic functions of polo-like kinase 1.
15176053 2004 Polo-like kinase 1 is overexpressed in prostate cancer and linked to higher tumor grades.
15148369 2004 Role of Polo-like kinase in the degradation of early mitotic inhibitor 1, a regulator of the anaphase promoting complex/cyclosome.
15141022 2004 Identification of human polo-like kinase 1 as a potential therapeutic target in pancreatic cancer.
15125835 2004 Mitotic phosphorylation of the peripheral Golgi protein Nir2 by Cdk1 provides a docking mechanism for Plk1 and affects cytokinesis completion.
15105433 2004 Hierarchical requirement of SWI/SNF in retinoblastoma tumor suppressor-mediated repression of Plk1.
15070733 2004 M-phase kinases induce phospho-dependent ubiquitination of somatic Wee1 by SCFbeta-TrCP.
15024021 2004 Polo-like kinase 1 (Plk1) inhibits p53 function by physical interaction and phosphorylation.
15015605 Polo-like kinase 1 (PLK1) expression is associated with cell proliferative activity and cdc2 expression in malignant lymphoma of the thyroid.
14735186 2004 Polo-like kinase 1 overexpression is an early event in the progression of papillary carcinoma.
14734534 2004 Ordered proteolysis in anaphase inactivates Plk1 to contribute to proper mitotic exit in human cells.
14654792 2003 Repression of mRNA for the PLK cell cycle gene after DNA damage requires BRCA1.
14592974 2003 The crystal structure of the human polo-like kinase-1 polo box domain and its phospho-peptide complex.
14532005 2003 The molecular basis for phosphodependent substrate targeting and regulation of Plks by the Polo-box domain.
12939256 2003 Phosphorylation of mitotic kinesin-like protein 2 by polo-like kinase 1 is required for cytokinesis.
12852857 2003 A role for Plk1 phosphorylation of NudC in cytokinesis.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12815053 2003 M phase-specific phosphorylation of BRCA2 by Polo-like kinase 1 correlates with the dissociation of the BRCA2-P/CAF complex.
12738781 2003 Identification of a consensus motif for Plk (Polo-like kinase) phosphorylation reveals Myt1 as a Plk1 substrate.
12732729 2003 Polo-like kinase (Plk)1 depletion induces apoptosis in cancer cells.
12708489 2003 Polo-like kinase 1 (PLK1) is overexpressed in primary colorectal cancers.
12639966 2003 Stk10, a new member of the polo-like kinase kinase family highly expressed in hematopoietic tissue.
12595692 2003 Proteomic screen finds pSer/pThr-binding domain localizing Plk1 to mitotic substrates.
12592388 2003 Beta-hydroxyisovalerylshikonin induces apoptosis in human leukemia cells by inhibiting the activity of a polo-like kinase 1 (PLK1).
12524548 2003 Active cyclin B1-Cdk1 first appears on centrosomes in prophase.
12493754 2003 Polo-like kinase 1 and Chk2 interact and co-localize to centrosomes and the midbody.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447691 2002 Cooperative phosphorylation including the activity of polo-like kinase 1 regulates the subcellular localization of cyclin B1.
12442251 2002 Identification of phosphorylation sites in the polo-like kinases Plx1 and Plk1 by a novel strategy based on element and electrospray high resolution mass spectrometry.
12429910 2002 Identification of promoter elements responsible for transcriptional inhibition of polo-like kinase 1 and topoisomerase IIalpha genes by p21(WAF1/CIP1/SDI1).
12364337 2002 Nuclear translocation of plk1 mediated by its bipartite nuclear localization signal.
12242661 2002 Mammalian Polo-like kinase 3 (Plk3) is a multifunctional protein involved in stress response pathways.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12207013 2002 Phosphorylation of threonine 210 and the role of serine 137 in the regulation of mammalian polo-like kinase.
12167714 2002 Plk phosphorylation regulates the microtubule-stabilizing protein TCTP.
12147700 2002 ATR enforces the topoisomerase II-dependent G2 checkpoint through inhibition of Plk1 kinase.
12077309 2002 Activation of Cdc2/cyclin B and inhibition of centrosome amplification in cells depleted of Plk1 by siRNA.
12034729 2002 A spindle checkpoint arrest and a cytokinesis failure by the dominant-negative polo-box domain of Plk1 in U-2 OS cells.
12024051 2002 Chk2 activation and phosphorylation-dependent oligomerization.
11931760 2002 The dissociation of cohesin from chromosomes in prophase is regulated by Polo-like kinase.
11901158 2002 Phosphorylation of threonine 68 promotes oligomerization and autophosphorylation of the Chk2 protein kinase via the forkhead-associated domain.
11897663 2002 Plk1 promotes nuclear translocation of human Cdc25C during prophase.
11854496 2002 Functional studies on the role of the C-terminal domain of mammalian polo-like kinase.
11447294 2001 Polo-like kinase is required for the fragmentation of pericentriolar Golgi stacks during mitosis.
11283617 2001 Polo kinase and Asp are needed to promote the mitotic organizing activity of centrosomes.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11242082 2001 Polo-like kinase 1 phosphorylates cyclin B1 and targets it to the nucleus during prophase.
11205743 2001 Polo-like kinase interacts with proteasomes and regulates their activity.
11202906 2000 The human polo-like kinase, PLK, regulates cdc2/cyclin B through phosphorylation and activation of the cdc25C phosphatase.
11194558 2000 Polo-like kinase expression in normal human endometrium during the menstrual cycle.
11127806 1999 Immunohistochemical localization of polo like kinase in early human placenta.
11111111 2000 Epidemiology of the antibiotic resistance of Helicobacter pylori in Canada.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10973490 2000 Ataxia telangiectasia-mutated phosphorylates Chk2 in vivo and in vitro.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10191277 1999 Association of polo-like kinase with alpha-, beta- and gamma-tubulins in a stable complex.
9499405 1998 The essential mitotic peptidyl-prolyl isomerase Pin1 binds and regulates mitosis-specific phosphoproteins.
9177283 1997 Malignant transformation of mammalian cells initiated by constitutive expression of the polo-like kinase.
9154840 1997 Plk is a functional homolog of Saccharomyces cerevisiae Cdc5, and elevated Plk activity induces multiple septation structures.
9083047 1997 Cell cycle regulation of the human polo-like kinase (PLK) promoter.
8991084 1996 Antibody microinjection reveals an essential role for human polo-like kinase 1 (Plk1) in the functional maturation of mitotic centrosomes.
8524282 1995 Plk is an M-phase-specific protein kinase and interacts with a kinesin-like protein, CHO1/MKLP-1.
8127874 1994 Induction and down-regulation of PLK, a human serine/threonine kinase expressed in proliferating cells and tumors.
8018557 1994 Cloning and characterization of human and murine homologues of the Drosophila polo serine-threonine kinase.
7962193 1994 Cell cycle analysis and chromosomal localization of human Plk1, a putative homologue of the mitotic kinases Drosophila polo and Saccharomyces cerevisiae Cdc5.
7902533 1993 Cell cycle- and terminal differentiation-associated regulation of the mouse mRNA encoding a conserved mitotic protein kinase.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7478607 1995 Identification and functional characterization of the human and murine polo-like kinase (Plk) promoter.