Property Summary

Ligand Count 180
NCBI Gene PubMed Count 533
PubMed Score 1271.15
PubTator Score 931.92

Knowledge Summary

Patent (74,781)

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.2e-06
Breast cancer 1.200 2.4e-09
breast carcinoma 1.400 1.2e-04
glioblastoma 1.200 3.2e-03
invasive ductal carcinoma 1.200 1.2e-04
lung adenocarcinoma 1.200 3.2e-07
malignant mesothelioma 1.800 2.2e-07
medulloblastoma 1.100 9.2e-05
medulloblastoma, large-cell 1.700 1.5e-05
non-small cell lung cancer 1.839 5.9e-26
osteosarcoma -1.120 4.2e-02
psoriasis 1.900 6.1e-102

PDB (54)

Gene RIF (472)

AA Sequence

MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEI      1 - 70
SDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLE     71 - 140
LHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKT    141 - 210
LCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAAS    211 - 280
LIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENP    281 - 350
LPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK    351 - 420
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHL    421 - 490
LKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFR    491 - 560
TYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS                               561 - 603
//

Text Mined References (548)

PMID Year Title