Property Summary

NCBI Gene PubMed Count 54
PubMed Score 73.49
PubTator Score 90.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
esophageal adenocarcinoma -1.100 4.6e-02
psoriasis 2.300 1.0e-05
glioblastoma 2.100 1.8e-06
osteosarcoma 1.826 1.4e-05
posterior fossa group A ependymoma 1.600 1.0e-10
astrocytoma 1.400 3.3e-03
atypical teratoid / rhabdoid tumor 1.700 5.9e-07
acute quadriplegic myopathy 1.148 7.4e-05
adrenocortical carcinoma 1.081 9.9e-03
pancreatic ductal adenocarcinoma liver m... 1.015 5.2e-03
diabetes mellitus -1.500 2.9e-03
pediatric high grade glioma 1.800 9.2e-07
pilocytic astrocytoma 1.600 3.7e-06
lung adenocarcinoma 1.200 4.2e-09
gastric carcinoma 1.100 2.7e-02
ovarian cancer 1.300 1.2e-03

Protein-protein Interaction (12)

Gene RIF (39)

PMID Text
26742848 Conserved amphipathic helices mediate lipid droplet targeting of PLIN1, PLIN2, and PLIN3.
26171795 Differential expression of PLIN3 and brefeldin A sensitivity may explain differential lipid oxidation efficiency in skeletal muscle among healthy lean, sedentary, and T2 diabetic males.
26170028 Results indicate that microRNAs miR-148a and miR-30a, regulate Tail interacting protein of 47 kDa (TIP47) expression and lipid droplets (LD) in hepatitis C virus infected cells.
25595097 Postprandial triglyceride rich lipoproteins may be involved in atherosclerotic plaque formation through the regulation of perilipin-2 and perilipin-3 proteins in macrophages.
25342854 Following exercise training, perilipin 3 protein expression was increased in the adipose tissue of women with polycystic ovary syndrome.
25039349 PLIN3 functions are intertwined with the lipogenic pathways implicated in sebaceous lipogenesis, such as desaturation and triglyceride synthesis.
24632837 Skeletal muscle perilipin 3 and coatomer proteins are increased following exercise and are associated with fat oxidation.
24480419 Rab9-complexed TIP47 plays an essential role for the proper release of hepatitis C viral particles.
23936516 PLIN3 is associated with the synthesis and secretion of PGE2
23705972 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
23593007 studies identified the lipid droplet(LD-associated host protein, Tail-Interacting Protein 47 (TIP47) as a novel NS5A interaction partner; data support a model where TIP47-via its interaction with NS5A-serves as a novel cofactor for HCV infection possibly by integrating LD membranes into the membranous web
23354285 TIP47 plays an essential role in the life cycle of hepatitis C virus.
23348195 TIP47 is here described for the first time as a viral restriction factor that acts by limiting viral protein synthesis.
23325685 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
23077317 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
22667335 PLIN2-PLIN5 proteins were all more abundant in women than in men (p = 0.037 and p < 0.0001, respectively), consistent with higher intramyocellular lipid content in female skeletal muscle.
22363329 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
21762802 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
20556887 Suppression of TIP47 in HeLa cells facilitated oxidative-stress-induced cell death.
20070608 TIP47 is required for the encounter between Gag and Env, and thus for the generation of infectious HIV-1 particles from primary macrophages.
20070608 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
20012524 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
19451273 TIP47 has apolipoprotein-like properties and reorganizes liposomes into small lipid discs
19400954 VV p37 protein associates with host TIP47, Rab9 and CI-MPR.
19286631 TIP47 (tail-interacting protein 47 kD) protein levels directly correlate with triglyceride levels; TIP47 may act as a carrier protein for free fatty acids and in this way participates in conversion of macrophages into foam cells
18832575 The present results suggest that lipid droplets (LD) and LD-associated proteins have protective effects against apoptosis induced by fatty acid-bound albumin by sequestering free fatty acids.
18557900 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
18393390 Adipophilin and TIP47 are expressed in LDs of vitamin A-storing hepatic stellate cells and additionally in lipid droplets of steatotic hepatocytes.
17003132 These results show that TIP47 is a cellular cofactor that plays an essential role in Env incorporation, allowing the encounter and the physical association between HIV-1 Gag and Env proteins during the viral assembly process.
17003132 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
16808905 The results suggested that the putative hydrophobic cleft is critical for the unique characteristics of TIP47.
16769818 Binding of the effector protein TIP47 is important for Rab9 localization.
16741517 we report the identity of an inhibitor, TIP47, which prevents retinylester hydrolysis catalyzed by GS2 lipase and hormone-sensitive lipase
15545278 TIP47 and adipophilin are components of many, but not all, the lipid droplets in THP-1 cells
15456905 Rab9 GTPase stability on late endosomes required interaction with TIP47
12768012 TIP47 binding to HIV-1 envelope glycoprotein (ENV) is required for ENV transport to the trans-golgi network and for its incorportaion into virions and its pathogenicity
12768012 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
12631276 Data show that placental protein 17b (PP17b)is a neutral lipid droplet-associated protein, and its expression is regulated by PKC- and PKA-dependent pathways
12077142 can co-localize with lipid storage proteins

AA Sequence

MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTL      1 - 70
TAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELVSSKVSGAQEMVSSAK     71 - 140
DTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAE    141 - 210
LARIATSLDGFDVASVQQQRQEQSYFVRLGSLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQVLSLME    211 - 280
TVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQG    281 - 350
LPTNVKDQVQQARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP    351 - 420
FAPGITEKAPEEKK                                                            421 - 434
//

Text Mined References (66)

PMID Year Title
26742848 2016 Conserved Amphipathic Helices Mediate Lipid Droplet Targeting of Perilipins 1-3.
26171795 2015 Perilipin 3 Differentially Regulates Skeletal Muscle Lipid Oxidation in Active, Sedentary, and Type 2 Diabetic Males.
26170028 2015 Epigenetic harnessing of HCV via modulating the lipid droplet-protein, TIP47, in HCV cell models.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25595097 2015 Postprandial triglyceride-rich lipoproteins regulate perilipin-2 and perilipin-3 lipid-droplet-associated proteins in macrophages.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25342854 2015 Potential effects of aerobic exercise on the expression of perilipin 3 in the adipose tissue of women with polycystic ovary syndrome: a pilot study.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25039349 2014 Perilipin 3 modulates specific lipogenic pathways in SZ95 sebocytes.
24632837 2014 Skeletal muscle perilipin 3 and coatomer proteins are increased following exercise and are associated with fat oxidation.
24480419 2013 TIP47 is associated with the hepatitis C virus and its interaction with Rab9 is required for release of viral particles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23936516 2013 Crucial role of perilipin-3 (TIP47) in formation of lipid droplets and PGE2 production in HL-60-derived neutrophils.
23593007 2013 Lipid droplet-binding protein TIP47 regulates hepatitis C Virus RNA replication through interaction with the viral NS5A protein.
23354285 2013 TIP47 plays a crucial role in the life cycle of hepatitis C virus.
23348195 2013 The cellular protein TIP47 restricts Respirovirus multiplication leading to decreased virus particle production.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22667335 2012 Perilipin family (PLIN) proteins in human skeletal muscle: the effect of sex, obesity, and endurance training.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21498505 2011 Human lysophosphatidylcholine acyltransferases 1 and 2 are located in lipid droplets where they catalyze the formation of phosphatidylcholine.
21269460 2011 Initial characterization of the human central proteome.
20556887 2010 TIP47 protects mitochondrial membrane integrity and inhibits oxidative-stress-induced cell death.
20070608 2010 TIP47 is required for the production of infectious HIV-1 particles from primary macrophages.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19638644 2010 Adoption of PERILIPIN as a unifying nomenclature for the mammalian PAT-family of intracellular lipid storage droplet proteins.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19490898 2009 RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.
19451273 2009 TIP47 functions in the biogenesis of lipid droplets.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19400954 2009 Vaccinia virus p37 interacts with host proteins associated with LE-derived transport vesicle biogenesis.
19286631 2009 TIP47, a lipid cargo protein involved in macrophage triglyceride metabolism.
18832575 2008 Lipid droplet-associated proteins protect renal tubular cells from fatty acid-induced apoptosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18393390 2008 Differential pattern of lipid droplet-associated proteins and de novo perilipin expression in hepatocyte steatogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17003132 2006 Tail-interacting protein TIP47 is a connector between Gag and Env and is required for Env incorporation into HIV-1 virions.
16808905 2006 Recruitment of TIP47 to lipid droplets is controlled by the putative hydrophobic cleft.
16769818 2006 TIP47 is a key effector for Rab9 localization.
16741517 2006 Molecular screening for GS2 lipase regulators: inhibition of keratinocyte retinylester hydrolysis by TIP47.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15545278 2005 Spatial integration of TIP47 and adipophilin in macrophage lipid bodies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456905 2004 Rab9 GTPase regulates late endosome size and requires effector interaction for its stability.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14741744 2004 Identification of major proteins in the lipid droplet-enriched fraction isolated from the human hepatocyte cell line HuH7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12768012 2003 Targeting of the human immunodeficiency virus type 1 envelope to the trans-Golgi network through binding to TIP47 is required for env incorporation into virions and infectivity.
12697764 2003 Characterization of the endosomal sorting signal of the cation-dependent mannose 6-phosphate receptor.
12631276 2003 Lipid droplet and milk lipid globule membrane associated placental protein 17b (PP17b) is involved in apoptotic and differentiation processes of human epithelial cervical carcinoma cells.
12535272 2003 Self-assembly is important for TIP47 function in mannose 6-phosphate receptor transport.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077142 2002 Functional conservation for lipid storage droplet association among Perilipin, ADRP, and TIP47 (PAT)-related proteins in mammals, Drosophila, and Dictyostelium.
12032303 2002 Identification of residues in TIP47 essential for Rab9 binding.
11359012 2001 Role of Rab9 GTPase in facilitating receptor recruitment by TIP47.
11313361 2001 TIP47 is not a component of lipid droplets.
10908666 2000 Recognition of the 300-kDa mannose 6-phosphate receptor cytoplasmic domain by 47-kDa tail-interacting protein.
10829017 2000 Quantitative analysis of TIP47-receptor cytoplasmic domain interactions: implications for endosome-to-trans Golgi network trafficking.
10393528 Cloning and sequencing of human oncodevelopmental soluble placental tissue protein 17 (PP17): homology with adipophilin and the mouse adipose differentiation-related protein.
9874244 1998 Cloning and sequence analysis of cDNAs encoding human placental tissue protein 17 (PP17) variants.
9590177 1998 TIP47: a cargo selection device for mannose 6-phosphate receptor trafficking.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6856484 1983 Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17).