Property Summary

NCBI Gene PubMed Count 73
PubMed Score 393.79
PubTator Score 226.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.060 7.0e-03
adrenocortical carcinoma -1.230 2.3e-02
Astrocytoma, Pilocytic 1.200 8.9e-03
atypical teratoid / rhabdoid tumor 1.500 3.2e-06
dermatomyositis 1.400 6.5e-04
glioblastoma 1.500 1.2e-03
group 3 medulloblastoma 1.200 4.1e-02
lung carcinoma -2.900 2.7e-25
malignant mesothelioma -2.600 1.5e-08
non-small cell lung cancer -1.069 2.4e-08
ovarian cancer -3.100 9.8e-08
pancreatic cancer 1.100 2.8e-02
pediatric high grade glioma 1.400 8.0e-03
pituitary cancer -2.900 3.6e-06
posterior fossa group A ependymoma 1.200 2.3e-03
primary pancreatic ductal adenocarcinoma 1.200 4.2e-02
psoriasis -1.100 4.5e-04
tuberculosis -2.700 1.9e-09

Gene RIF (64)

AA Sequence

MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSVAMTSALPIIQ      1 - 70
KLEPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDK     71 - 140
TKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDL    141 - 210
VQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDK    211 - 280
LYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMA    281 - 350
GDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGA    351 - 420
EMDKSSQETQRSEHKTH                                                         421 - 437
//

Text Mined References (79)

PMID Year Title