Property Summary

NCBI Gene PubMed Count 70
PubMed Score 558.90
PubTator Score 340.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.500 2.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.747 8.2e-03
acute quadriplegic myopathy 1.379 7.0e-07
Atopic dermatitis -2.400 5.2e-03
adrenocortical adenoma -1.081 1.4e-02
adrenocortical carcinoma -1.296 6.5e-06
fibroadenoma -3.200 3.5e-02
posterior fossa group B ependymoma 1.100 1.2e-03
non primary Sjogren syndrome sicca 1.400 1.3e-02
inflammatory breast cancer -1.100 3.3e-02
breast carcinoma -2.600 4.8e-19
ductal carcinoma in situ -4.300 2.5e-04
invasive ductal carcinoma -6.300 1.1e-04
ovarian cancer -1.200 4.0e-03

Synonym

Accession O60240 Q8N5Y6
Symbols PERI
PLIN
FPLD4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
651672 confirmatory 195 / 0 / 39 Counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical high throughput dose response assay to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-1 (PLIN1)
652125 confirmatory 20 / 0 / 28 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-1 (PLIN1)(ROUND 2)

Gene RIF (79)

PMID Text
27468581 Based on the PCR with mismatched primers PLIN1 polymorphisms could be identified effectively in Chinese Han population.
26742848 Conserved amphipathic helices mediate lipid droplet targeting of PLIN1, PLIN2, and PLIN3.
25971423 Skeletal muscle PLIN proteins likely play a role in the hydrolysis of triglycerides stored in lipid droplets and the passage of fatty acids to the mitochondria for oxidation.
25529448 The functional PLIN1 rs6496589 may influence the risk of central obesity through possible regulation of lipid storage.
25114292 This plin1 variant binds and stabilizes ABHD5 expression but still fails to inhibit basal lipolysis as effectively as wild-type perilipin 1.
24610610 Use of molecular docking software to design perilipin-1 inhibitors as antiobesity agents.
24269473 In long-term steatosis models in vitro, TIP47, MLDP, adipophilin, and finally perilipin were gradually induced
24126816 After bariatric surgery-induced weight loss, PLIN1 gene/protein expression in SAT increased significantly. Findings suggest a positive functional interaction between PLIN1 & mitochondrial biogenesis-related genes in human adipose tissue.
23642680 Although specific for invasive sebaceous carcinoma, perilipin expression was not helpful in distinguishing sebaceous carcinoma in situ from squamous cell carcinoma in situ with clear cell change.
23517113 Chinese adults with high waist circumference may have a high risk of diabetes, especially those with allele T in rs1052700 or with allele A in rs894160 of perilipin gene and those with perilipin genotype AA (rs894160) may have a high risk of obesity.
23392103 Perilipin is almost exclusively expressed in white adipocytes, so the serious metabolic sequelae observed in patients suggest that primary defects in adipose tissue can lead to all the typical features seen in patients with the metabolic syndrome.[review]
23111648 Independently and in an interactive manner, PLIN (and ENPP1) contribute to the risk of type 2 diabetes in a Taiwanese population.
22730012 PKC activation is required for TSH-stimulated perilipin phosphorylation and lipolysis in differentiated adipocytes.
22580060 The morning cortisol increase as indicated by CAR correlated positively and significantly with hPER1 gene expression in older women suggesting that hPER1 expression increases in response to the morning cortisol increase in older women
22535977 Reduced mRNA and protein content of Plin and G0S2 and borderline increased ATGL protein in sc adipose tissue from poorly controlled type 2 diabetic subjects.
21392418 genetic association studies in obese women in Spain (gene-diet interactions): Women on reducing diet who carry 11482(G>A) A allele have lower reduction in waist circumference and greater decrease in lipid oxidation rate than non-A allele carriers.
21345103 Identified two heterozygous frameshift mutations in the perilipin gene (PLIN1) in three families with partial lipodystrophy, severe dyslipidemia, and insulin-resistant diabetes; findings define a novel dominant form of inherited lipodystrophy.
21193293 genetic association studies in populations in US Midwest (MN, UT): When ratio of saturated fat to carbohydrate is high in diet, plasma insulin and insulin resistance are higher in women who are carriers of the minor allele in a PLIN1 SNP (rs894160).
20734064 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20495294 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20163070 This study found no incrased risk of obesity in Chinese Han adults with a single nucleotide polymorphism of perilipin.
20163070 Observational study of gene-disease association. (HuGE Navigator)
20032580 Expression patterns of perilipin and adipophilin in nonalcoholic fatty liver disease livers vary with the size of lipid droplets
20017959 The present study aimed at comparing expression and subcellular distribution of perilipin and hormone-sensitive lipase in two abdominal adipose tissues of lean and obese women.
19850727 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19797618 a novel role for perilipin expression in adipose tissue metabolism and regulation of obesity and its metabolic complications
19782423 Variation in PLIN may affect glucose and lipid metabolism in women both with and without ariation in PLIN may affect glucose and lipid metabolism in women both with and without polycystic ovary syndrome.
19782423 Observational study of gene-disease association. (HuGE Navigator)
19695247 TNFalpha decreased ATGL and HSL protein content and triglycerides (TG)-hydrolase activity but increased basal lipolysis due to a marked reduction in perilipin protein content
19399648 K121Q, rs7566605, and rs894160 are not major contributing factors for obesity for ENPP1, INSIG2 and PLIN
19399648 Observational study of gene-disease association. (HuGE Navigator)
19385027 The haplotype of the minor alleles PLIN1-4, PLIN5-7 and PLIN6, was related to body-weight regulation at a lower level of body-weight in the men as well in the women; the PLIN1-4, 6, and 5-7 locus appears as a genetic influencer of obesity risk in humans.
19385027 Observational study of gene-disease association. (HuGE Navigator)
19299455 evidence is presented for perilipin expression in rat, mouse, and human islets of Langerhans as well as the rat clonal beta-cell line INS-1
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19054096 Mycobacterium leprae regulates ADRP/perilipin expression to facilitate the accumulation of lipids within infected macrophages for intracellular survival.
18812483 The minor A allele at PLIN was associated with higher risk of metabolic syndrome at baseline
18812483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18806092 Associations between PLIN gene polymorphisms and obesity risk have been described but this study shows that interactions with dieetary carbohydrates affect waist size.
18806092 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18777456 Polymorphisms in perilipin gene (PLIN) are not associated with obesity and weight variation in people with high risk of type 2 diabetes.
18393390 Perilipin, which was thought to be characteristic for lipid droplets of adipocytes and steroidogenic cells, becomes de novo expressed in hepatocytes of human, mouse, and cattle liver.
18356850 Central obesity may modify the associations between PLIN variations and diabetes risk in women.
18356850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18326614 These 2 studies suggest that the presence of the minor C and A alleles at PLIN1 and PLIN4, respectively, are associated with a lower postprandial response that may result in lower atherogenic risk for these persons
18326614 Observational study of gene-disease association. (HuGE Navigator)
18243128 Thus, the perilipin gene expression is regulated by a transcriptional network controlling energy metabolism, substantiating the functional importance of perilipin in the maintenance of body energy balance.
18201980 The results of these studies demonstrated that A. phagocytophilum modulates lipid metabolism by increasing PLIN mRNA levels and facilitates infection of HL-60 cells.
18174481 Observational study of gene-disease association. (HuGE Navigator)
18174481 negative finding that the common variants of PLIN do not have a major effect on susceptibility to stroke in a Chinese population
17927964 Perilipin content decreased and adipophilin increased with lipoprotein lipid loading regardless of intracellular neutral lipid composition
17353663 PLIN is a candidate gene for obesity risk in humans as well as a modulator of dietary response to therapies aimed to reduce body weight and decrease metabolic syndrome risk. [REVIEW]
16836753 Observational study of gene-disease association. (HuGE Navigator)
16836753 The rs4578621 and rs894160 polymorphisms of the perilipin gene are not major genetic determinants of obesity and type 2 diabetes-related phenotypes in a random sample of French men and women.
16786163 Observational study of gene-disease association. (HuGE Navigator)
16786163 Results suggest that that PLIN constitutes a susceptibility locus for reduced BMD in Japanese men.
16732015 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16732015 Genetic variations in the perilipin gene can affect weight gain associated with rosiglitazone treatment in patients with type 2 diabetes.
16732014 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16732014 PLIN 11482G-->A/14995A-->T polymorphisms modulate the association between SFAs/carbohydrate in diet and insulin resistance in Asian women.
16585946 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16567422 Cooperation with other transcription factors may be differentially involved in selective transactivation of the perilipin gene by different peroxisome proliferator-activated receptor subtypes.
16243839 Perilipin targets a novel pool of lipid droplets for lipolytic attack by hormone-sensitive lipase
15985482 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15985482 PLIN11482A carriers were resistant to weight loss, suggesting that this polymorphism may predict outcome of BW reduction strategies based on low-energy diets.
15961705 We show the presence and induction of perilipin in atheroma.
15770500 Observational study of gene-disease association. (HuGE Navigator)
15770500 The association of increased obesity risk and structure of PLIN gene is studied; results support the role of the PLIN locus as an ethnically dependent modulator of obesity risk in humans.
15601970 Observational study of gene-disease association. (HuGE Navigator)
15601970 data support the hypothesis that the perilipin(PLIN) locus may be a significant genetic determinant for obesity risk in whites and that women are more sensitive to the genetic effects of perilipin than men
15601966 Observational study of gene-disease association. (HuGE Navigator)
15601966 study suggested a significant contribution of perilipin(PLIN) polymorphism 1243 to the elevated total cholesterol (TC) levels indicating that PLIN gene may be involved in human lipid metabolism
15355432 Observational study of gene-disease association. (HuGE Navigator)
15355432 Genetic variation at the perilipin (PLIN) locus is associated with obesity-related phenotypes in White women
15111493 Transcription of the human perilipin gene is stimulated by peroxisome proliferator-activated receptor-gamma (PPAR-gamma) through a DR-1 type PPRE.
15001633 perilipin was elevated in obese subjects, perhaps as a compensatory mechanism to limit basal lipolysis.
12802495 Perilipin could be a factor behind impaired lipolysis in insulin-resistants sconditions.

AA Sequence

MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAA      1 - 70
WSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSD     71 - 140
KVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLPPDKEESAPAPGHQQAQK    141 - 210
SPKAKPSLLSRVGALTNTLSRYTVQTMARALEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVR    211 - 280
VPWLHSLAAAQEEDHEDQTDTEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAV    281 - 350
TWAPAAVLGMAGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID    351 - 420
NPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAPRPGFPAVPRE    421 - 490
KPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS                                          491 - 522
//

Text Mined References (73)

PMID Year Title
27468581 2016 An Improved PCR-RFLP Assay for the Detection of a Polymorphism of PLIN1 Gene.
26742848 2016 Conserved Amphipathic Helices Mediate Lipid Droplet Targeting of Perilipins 1-3.
25971423 2015 Piecing together the puzzle of perilipin proteins and skeletal muscle lipolysis.
25529448 2015 A functional variant in the exon 5 of PLIN1 reduces risk of central obesity by possible regulation of lipid storage.
25114292 2015 Clinical and molecular characterization of a novel PLIN1 frameshift mutation identified in patients with familial partial lipodystrophy.
24610610 2014 In silico discovery of a perilipin 1 inhibitor to be used as a new treatment for obesity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269473 2014 Perilipin discerns chronic from acute hepatocellular steatosis.
24126816 2014 CIDEC/FSP27 and PLIN1 gene expression run in parallel to mitochondrial genes in human adipose tissue, both increasing after weight loss.
23642680 2013 Perilipin and adipophilin expression in sebaceous carcinoma and mimics.
23517113 2013 Association between three genetic variants of the Perilipin Gene (PLIN) and glucose metabolism: results from a replication study among Chinese adults and a meta-analysis.
23399566 2013 FSP27 and PLIN1 interaction promotes the formation of large lipid droplets in human adipocytes.
23392103 2013 Human congenital perilipin deficiency and insulin resistance.
23111648 2012 Evaluation of the ENPP1 and PLIN single nucleotide polymorphisms with type 2 diabetes in a Taiwanese population: evidence for replication and gene-gene interaction.
22730012 2012 PKC activation is required for TSH-mediated lipolysis via perilipin activation.
22580060 2012 The cortisol awakening response is related with PERIOD1 clock gene expression in older women.
22535977 2012 Reduced mRNA and protein expression of perilipin A and G0/G1 switch gene 2 (G0S2) in human adipose tissue in poorly controlled type 2 diabetes.
21392418 2011 Preliminary findings on the role of PLIN1 polymorphisms on body composition and energy metabolism response to energy restriction in obese women.
21345103 2011 Perilipin deficiency and autosomal dominant partial lipodystrophy.
21193293 2012 Perilipin polymorphism interacts with saturated fat and carbohydrates to modulate insulin resistance.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20495294 2010 Association of lifestyle factors, polymorphisms in adiponectin, perilipin and hormone sensitive lipase, and clinical markers in Japanese males.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20163070 2009 Perilipin gene 1237 T > C polymorphism is not associated with obesity risk in northern Chinese Han adults.
20032580 2009 Expression of perilipin and adipophilin in nonalcoholic fatty liver disease; relevance to oxidative injury and hepatocyte ballooning.
20017959 2009 Depot-specific differences in perilipin and hormone-sensitive lipase expression in lean and obese.
19850727 2010 Endurance exercise training effects on body fatness, VO2max, HDL-C subfractions, and glucose tolerance are influenced by a PLIN haplotype in older Caucasians.
19797618 2010 Perilipin overexpression in mice protects against diet-induced obesity.
19782423 2009 Variation in the perilipin gene (PLIN) affects glucose and lipid metabolism in non-Hispanic white women with and without polycystic ovary syndrome.
19695247 2009 Chronic TNFalpha and cAMP pre-treatment of human adipocytes alter HSL, ATGL and perilipin to regulate basal and stimulated lipolysis.
19638644 2010 Adoption of PERILIPIN as a unifying nomenclature for the mammalian PAT-family of intracellular lipid storage droplet proteins.
19399648 2009 Possible role for ENPP1 polymorphism in obesity but not for INSIG2 and PLIN variants.
19385027 2009 Relationship between perilipin gene polymorphisms and body weight and body composition during weight loss and weight maintenance.
19299455 2009 Perilipin is present in islets of Langerhans and protects against lipotoxicity when overexpressed in the beta-cell line INS-1.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
19054096 2008 Expression of adipose differentiation-related protein (ADRP) and perilipin in macrophages infected with Mycobacterium leprae.
18812483 2008 Effects of perilipin (PLIN) gene variation on metabolic syndrome risk and weight loss in obese children and adolescents.
18806092 2008 Perilipin polymorphism interacts with dietary carbohydrates to modulate anthropometric traits in hispanics of Caribbean origin.
18777456 2008 Polymorphisms in perilipin gene (PLIN) are not associated with obesity and weight variation in people with high risk of type 2 diabetes.
18393390 2008 Differential pattern of lipid droplet-associated proteins and de novo perilipin expression in hepatocyte steatogenesis.
18356850 2008 Common variations in perilipin gene, central obesity, and risk of type 2 diabetes in US women.
18326614 2008 Postprandial triacylglycerol metabolism is modified by the presence of genetic variation at the perilipin (PLIN) locus in 2 white populations.
18243128 2008 Perilipin, a critical regulator of fat storage and breakdown, is a target gene of estrogen receptor-related receptor alpha.
18201980 2008 Expression of perilipin in human promyelocytic cells in response to Anaplasma phagocytophilum infection results in modified lipid metabolism.
18174481 2008 No association of PLIN polymorphisms with hemorrhagic and ischemic stroke.
17927964 2007 Perilipin and adipophilin expression in lipid loaded macrophages.
17353663 2007 The role of perilipin in human obesity and insulin resistance.
16836753 2006 Study of the impact of perilipin polymorphisms in a French population.
16786163 2006 Association of polymorphisms in forkhead box C2 and perilipin genes with bone mineral density in community-dwelling Japanese individuals.
16732015 2006 The 11482G >A polymorphism in the perilipin gene is associated with weight gain with rosiglitazone treatment in type 2 diabetes.
16732014 2006 Perilipin gene variation determines higher susceptibility to insulin resistance in Asian women when consuming a high-saturated fat, low-carbohydrate diet.
16585946 2006 Genetic variation at the perilipin locus is associated with changes in serum free fatty acids and abdominal fat following mild weight loss.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16567422 2006 Peroxisome proliferator-activated receptor subtypes differentially cooperate with other transcription factors in selective transactivation of the perilipin/PEX11 alpha gene pair.
16243839 2005 Perilipin targets a novel pool of lipid droplets for lipolytic attack by hormone-sensitive lipase.
15985482 2005 Obese subjects carrying the 11482G>A polymorphism at the perilipin locus are resistant to weight loss after dietary energy restriction.
15961705 2005 Genes of cholesterol metabolism in human atheroma: overexpression of perilipin and genes promoting cholesterol storage and repression of ABCA1 expression.
15770500 2005 Intragenic linkage disequilibrium structure of the human perilipin gene (PLIN) and haplotype association with increased obesity risk in a multiethnic Asian population.
15601970 2004 Gender-specific association of a perilipin gene haplotype with obesity risk in a white population.
15601966 2004 Polymorphisms in PLIN and hypertension combined with obesity and lipid profiles in Han Chinese.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355432 2004 Genetic variation at the perilipin (PLIN) locus is associated with obesity-related phenotypes in White women.
15111493 2004 Adipose tissue expression of the lipid droplet-associating proteins S3-12 and perilipin is controlled by peroxisome proliferator-activated receptor-gamma.
15078502 2004 Depot-specific differences in perilipin mRNA but not protein expression in obesity.
15001633 2004 Perilipin expression in human adipose tissue is elevated with obesity.
14527948 2003 Lipase-selective functional domains of perilipin A differentially regulate constitutive and protein kinase A-stimulated lipolysis.
12917496 2003 Perilipin expression in human adipose tissues: effects of severe obesity, gender, and depot.
12802495 2003 Evidence for an important role of perilipin in the regulation of human adipocyte lipolysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453889 2002 Marked heterogeneity of human skeletal muscle lipolysis at rest.
11751901 2002 Modulation of hormone-sensitive lipase and protein kinase A-mediated lipolysis by perilipin A in an adenoviral reconstituted system.
9521880 1998 Isolation and chromosomal mapping of the human homolog of perilipin (PLIN), a rat adipose tissue-specific gene, by differential display method.