Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.93
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 9.0e-09
ependymoma 1.100 9.4e-10
glioblastoma 1.100 4.3e-07
group 3 medulloblastoma 1.400 1.7e-05
malignant mesothelioma 1.100 1.8e-06
ovarian cancer 1.100 5.8e-03
pediatric high grade glioma 1.100 2.0e-04
psoriasis 1.200 6.5e-11

Gene RIF (4)

AA Sequence

MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTA      1 - 70
GAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQ     71 - 140
SRFFIDK                                                                   141 - 147
//

Text Mined References (17)

PMID Year Title