Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 15.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 7.7e-04
atypical teratoid / rhabdoid tumor -1.800 7.6e-05
ependymoma -1.300 1.7e-06
gastric cancer 1.500 8.2e-03
glioblastoma -2.000 3.0e-05
medulloblastoma, large-cell -1.600 6.7e-03
osteosarcoma -2.357 2.3e-07
ovarian cancer -1.300 1.1e-04
pancreatic ductal adenocarcinoma liver m... -2.369 7.9e-03
pediatric high grade glioma -1.400 8.6e-04
Pick disease -1.200 8.7e-05

Synonym

Accession Q02325 Q580R1
Symbols PLGL
PRGB
PLGP1
PRP-B

Gene

Gene RIF (2)

AA Sequence

MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKE      1 - 70
QQCVIMAENRKSSIIIRMRDAVLFEK                                                 71 - 96
//

Text Mined References (9)

PMID Year Title