Property Summary

NCBI Gene PubMed Count 5
PubMed Score 15129.12
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Atherosclerosis 291 4.959 2.5
Disease Target Count Z-score Confidence
Thrombophilia 38 5.613 2.8

Synonym

Accession Q15195
Symbols PRGA
PLGP2
PLGLA1

Gene

 GO Component (1)

AA Sequence

MEHKEVVLLLLLFLKSGQGEPLDDYVNAQGASLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKE      1 - 70
QQCVIMAENKKSSIIIRMRDVVLFEK                                                 71 - 96
//

Text Mined References (5)

PMID Year Title