Property Summary

NCBI Gene PubMed Count 321
PubMed Score 5412.91
PubTator Score 3409.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1795 8.8e-03
nephrosclerosis 329 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Atherosclerosis 275 4.7 2.4
Disease Target Count Z-score Confidence
Thrombophilia 37 5.602 2.8
Disease Target Count
Plasminogen deficiency 1

Expression

  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -1.807 4.1e-02
pancreatic ductal adenocarcinoma liver m... -3.582 8.8e-03

Protein-protein Interaction (8)

Gene RIF (184)

PMID Text
26667841 Plasminogen binding and activation by different glycolytic enzymes of M. pneumoniae play a role in successful colonization of the human respiratory tract.
26637181 reduced proteolytic activity of plasmin on structures of growing thrombi, rather than on complement activation fragments, explains the association of plasminogen deficiency with aHUS.
26359437 These results indicate that FXIIIa activity can be modulated by fibrinolytic enzymes, and suggest that changes in fibrinolytic activity may influence cross-linking of blood proteins.
26070561 These studies demonstrate that GAS virulence can be explained by disparate hPg activation by SK2a and SK2b coupled with the coinherited M-proteins of these strains
26067271 whereas the presence of plasminogen did not affect the factor I cofactor activity of C4BP, the activation of plasminogen by urokinase-type plasminogen activator to active plasmin was significantly augmented in the presence of C4BP.
26029848 PAM activated Plasminogen Glycoform II.
25993872 IGF-II, TGF-beta1 and VEGF-A and its receptor in malignant tumor tissue, as well as increasedplasmin release from proenzyme and MMP-3 activationis apparently associated with the formation of pathogenic mechanism of vasculature development
25971850 Suggest that tubulointerstitial plasmin is associated with inflammation leading to renal fibrosis, and can cause the decline in renal function seen in patients with IgA nephropathy.
25789495 Zinc modulates fibrinolysis by attenuating tPA-mediated plasminogen activation and plasmin-induced fibrin degradation.
25712989 Data show that different subpopulations of platelets harbor plasminogen by diverse mechanisms
25556624 Plasmin cleavage of iC3b provides a complement regulatory pathway that is as efficient as FI/CR1 but does not require a cellular cofactor.
25466412 PLG is the third replicated shared genetic risk factor of atherosclerosis and periodontitis.
25409527 manganese transport protein C (MntC) is an extracellular matrix- and plasminogen-binding protein
25407528 This review highlights the importance of the best-characterized components of the PLG/PLA cascade in the pathogenesis of cancer focusing on the role of the cell surface-PLG receptors (PLG-R). [review]
25222106 Human plasmin activity loss results from the C-terminal lysine-dependent redistribution of enzyme molecules on a fibrin surface.
25208887 Genome-wide association analyses revealed common DNA variants in PLG, LPA, and near SIGLEC14 that contribute to plasma plasminogen level variation.
25138220 Binding of streptokinase Lys(414) to plasminogen kringle 4 plays a role in recognition of plasminogen by streptokinase.
25128532 Reduced plasminogen binding and delayed activation render gamma'-fibrin more resistant to lysis than gammaA-fibrin.
25059665 Data indicate that binding of tissue-type plasminogen activator (t-PA) to glucose-regulated protein 78 (GRP78) stimulates its amidolytic activity, activation of plasminogen (Pg), and cell proliferation.
24909805 High plasma fibrinogen and low plasminogen are associated with poor survival in CTEPH patients without modern therapy.
24840471 The results suggested that EF-Tu and Eno serve as surface receptors for B. longum NCC2705 binding to human plasminogen.
24605649 System of activation of plasminogen in Vibrio cholerae
24457100 ANG interacts with plasminogen activation system at the leading edges of breast cancer cell surfaces and facilitates interactions of uPAR with uPA to regulate plasmin formation and cell migration.
24449821 We propose that plasminogen activation on endothelial cells acts as a natural backup for ADAMTS13 to degrade obstructive platelet-VWF complexes.
24338014 Generation of angiostatin in blood involves activation of plasminogen to the serine protease plasmin and facilitated cleavage of two disulfide bonds and up to three peptide bonds in the kringle 5 domain of the protein.
24205998 Angiostatin may play a role in the pathophysiology of preeclampsia.
24029428 PLG carried more pathogenic variants than any other coagulation gene, including three known plasminogen deficiency mutations and a predicted pathogenic variant in atypical hemolytic uremic syndrome.
23969887 Data show that preincubation with plasminogen, wild-type group A Streptococcus (GAS) NS88.2 degraded complement C3b.
23912396 Hepatocellular carcinoma shows significantly elevated serum levels of angiogenic factors VEGF and Ang-2 and of anti-angiogenic factors endostatin and angiostatin.
23906818 The surface-displayed enolase, which serves as major pneumococcal plasminogen receptor, was identified as a key factor for plasminogen-mediated bacterial attachment in infection analyses with Streptococcus pneumoniae.
23853591 Data suggest plasminogen is involved in susceptibility/resistance to Group A streptococcal infection (GAS); mice expressing human plasminogen transgene are more susceptible to invasive GAS than urokinase-type plasminogen activator knockout mice.
23850366 The results demonstrate that Bacteroides fragilis Bfp60 surface adhesin is responsible for the recognition of laminin and plasminogen-plasmin activation.
23721211 Plasminogen stimulates autocrine cytokine production in human airway smooth muscle cells in a manner mediated by plasmin and annexin A2.
23702659 These findings highlight a critical role for plasmin in the catabolism of aggregated LDL by macrophages and provide a new context for considering the atherogenic role of plasmin.
23699598 Glycation of plasminogen in diabetes directly affects fibrinolysis by decreasing plasmin generation and reducing protein-specific activity, changes that are reversible with modest improvement in glycemic control.
23645683 Data indicate that plasmin cleavage attenuates PlGF-2-mediated VEGFR-1 phosphorylation.
23583624 Authors show that plasminogen can be recruited to the surface of Fusobacterium necrophorum and that surface-bound plasminogen is more easily converted to active plasmin than plasminogen in buffer.
23576799 Further, plasmin stimulates the NF-kappaB/p38-dependent expression of ICAM-1 by human umbilical vein endothelial cells.
23481605 Unlike SCM, which binds to the C terminus of human plasminogen, the Streptococcus canis enolase interacts N terminally with the first four kringle domains of plasminogen, representing angiostatin.
23449787 Cleavage activation of HA by plasmin/plasminogen was independent of the viral NA.
23341464 Data indicate that endopeptidase O (PepO) is a ubiquitously expressed plasminogen- and fibronectin-binding protein, which plays role in pneumococcal invasion of host cells and aids in immune evasion.
23150713 Multistep chromatographic fractionation of human serum identifies plasminogen as a novel factor that promotes phagocytic clearance of apoptotic cells.
23140098 Letter: Plasmin and the thrombin-thrombomodulin complex both contribute to thrombin-activatable fibrinolysis inhibitor activation in whole blood model thrombi.
23118497 Plasmin triggers release of the chemokine CCL20 from dendritic cells.
23103380 The enolase EnoA1 of Lactobacillus plantarum is here shown to interact with human plasminogen.
23071827 Staphylococcus aureus proteins Sbi and Efb recruit human plasmin to degrade complement C3 and C3b.
23071278 Lpd is a novel surface-exposed virulence factor of P. aeruginosa that binds Factor H, FHL-1, CFHR1, and plasminogen, and the Lpd-attached regulators are relevant for innate immune escape and most likely contribute to tissue invasion.
22996753 suggest that the extensive backcrossing performed prior to our studies has eliminated the confounding effect of a known polymorphic metastasis modifier gene region located adjacent to the Plg gene
22987920 Data suggest that proteolytic activation of ENaC by plasmin may contribute to Na(+) retention and hypertension in preeclampsia.
22974122 plasminogen and plasmin but not tissue-type plasminogen activator have roles in regulating fibrinolysis by C-terminal lysines
22832192 The structure of closed plasminogen reveals that the PAp and SP domains, together with chloride ions, maintain the closed conformation through interactions with the kringle array.
22732096 The Lsa30 (LIC110870) is a novel adhesin that binds plasminogen and the complement regulator C4bp.
22685231 Lys-plasminogen, an amino-terminal truncated form of plasminogen, was identified as the binding protein to ADAMTS13.
22677171 Alendronate promotes plasmin-mediated MMP-9 inactivation by exposing cryptic plasmin degradation sites within the MMP-9 catalytic domain
22641690 A new pathway triggered by cell confluence that regulates basement membrane (BM) protein composition by suppressing the uPA-uPAR-plasmin pathway, was identified.
22619171 Plasmin cleaved mainly the N-terminal region of alpha-syn and also inhibited the translocation of extracellular alpha-syn into the neighboring cells in addition to the activation of microglia and astrocytes by extracellular alpha-syn.
22518846 SUPA formed a higher avidity complex (118-fold) with bovine Pg than with human Pg and non-proteolytically activated bovine but not human Pg.
22507544 Report complex interplay between the fibrinogen- and plasminogen-dependent antiadhesive systems, which may contribute to the mechanisms that control the adhesiveness of a fibrin shell on the surface of hemostatic thrombi.
22287006 TNF-alpha modulateds the plasminogen-mediated Bifidobacterium animalis subsp. lactis -enterocyte interaction, reducing the bacterial adhesion to the enterocytes and enhancing migration to the luminal compartment.
22197896 homocysteine and its thiolactone may affect fibrinolytic properties of plasminogen and plasma, leading to the decrease of plasmin activity
22187433 A high affinity interaction of plasminogen with fibrin is not essential for efficient activation by tissue-type plasminogen activator
22147698 Calcium binding to leptospira outer membrane antigen LipL32 is not necessary for its interaction with plasma fibronectin, collagen type IV, and plasminogen.
22124123 PE is a major plasminogen-binding protein of the Gram-negative bacterium H. influenzae, and when converted to plasmin, PE-bound plasmin aids in immune evasion and contributes to bacterial virulence.
22079981 Dengue virus-induced Plg cross-reactive antibodies may enhance Plg conversion to plasmin, which could contribute to hyperfibrinolysis in patients with dengue hemorrhagic fever/dengue shock syndrome.
22027013 Te results of this study suggested taht genetic variations in MMEL1, ECE1, ECE2, AGER, PLG, PLAT, NR1H3, MMP3, LRP1, TTR, NR1H2, and MMP9 genes do not play major role among the Finnish AD patient cohort.
21998162 Blood-brain barrier invasion by Cryptococcus neoformans is enhanced by functional interactions with plasmin.
21832858 Studies indicate that plasmin is present in the urine of patients with the nephrotic syndrome, but not under normal conditions.
21802507 PLA-coated leptospires interfere with complement C3b and IgG depositions on the bacterial surface.
21787393 MMP-19 processes human plasminogen in a characteristic cleavage pattern to generate three angiostatin-like fragments
21755014 Lsa66 is a novel OmpA-like protein with dual activity that may promote the attachment of Leptospira to host tissues and may contribute to the leptospiral invasion.
21680799 Results identify neoepitopes latent in soluble Glu-plasminogen that become available when Glu-plasminogen binds to cells.
21543325 When the C terminus of alpha(2)-antiplasmin was removed, the binding affinity for active site-blocked plasmin remained high, suggesting additional exosite interactions between the serpin core and plasmin.
21510941 Site-directed mutagenesis of staphylokinase(SAK) His43 and SAKTyr44 demonstrated the crucial requirement of a positively charged and an aromatic residue, respectively, at these positions for optimal functioning of SAK-plasmin activator complex.
21467042 an interaction between TAFIa and plasminogen comprises a component of the reaction mechanism, the plausibility of which was established by showing that TAFIa binds both Glu-Pg and Lys-Pg.
21464960 PLG-bound spores were capable of exhibiting anti-opsonic properties by cleaving C3b molecules in vitro and in rabbit bronchoalveolar lavage fluid.
21316746 Plasmin generation was greatly enhanced by alpha-2-antiplasmin deficiency.
21300353 demonstrated differential immunoexpression patterns between native Lp(a) and plasminogen, and suggested that Lp(a)-plasminogen interaction may play a part in differential mechanisms in all atherosclerotic lesions of carotid and cerebral arteries
21236472 The study shows that the alternative pathway for plasmin-mediated fibrinolysis by leukocyte elastase is activated, and contributes to the degradation of cross-linked fibrin in sepsis-induced disseminated intravascular coagulation.
21174000 analysis of novel plasminogen (PLG) gene mutations in a series of 23 patients with low PLG activity
21072208 Data suggest that the pathomechanism of plasminogen activation is conserved in oral streptococci.
20726765 The results suggest that expression of staphylokinase followed by activation of plasminogen alleviates the course of Staphylococcus aureus sepsis.
20709033 Plasmin activity is reduced in Alzheimer's disease (AD) but does not reach statistical significance; the data do not support involvement of plasmin in the abnormal accumulation of amyloidbeta in AD.
20702651 These results indicate that plasminogen promotes influenza A virus replication in an annexin 2-dependent fashion in the absence of viral neuraminidase.
20655859 insights into the mechanisms for the tight and highly specific interaction of the kringle 2 domain of human plasminogen (K2(Pg)) with a 30-residue internal peptide
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20617841 Using a recombinant construct expressed in Escherichia coli, the three-dimensional solution structure of plasminogen kringle 3 domain was determined via NMR spectroscopy.
20565259 Borrelia burgdorferi CRASP-1 binds to several human extracellular matrix proteins and plasminogen that may contribute to adhesion, bacterial colonization, and organ tropism and may allow dissemination of Borrelia burgdorferi in the host.
20553606 Hsp90alpha is released by invasive cancer cells via exosomes and activates plasmin, a second protease that acts in cancer cell invasion.
20346413 Naturally occurring human plasminogen, like genetically related apolipoprotein(a), contains oxidized phosphatidylcholine adducts.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20152941 Effects on human plasminogen conformation and activation rate caused by interaction with VEK-30, a peptide derived from the group A streptococcal M-like protein (PAM).
20143645 elevated plasma levels in patients with hereditary angioedema
20140262 Observational study of gene-disease association. (HuGE Navigator)
20112045 Results describe the functional characterization of the unique plasmin(ogen)-binding region of the human alpha(2)-plasmin inhibitor.
20095998 Identify plasminogen as a protein that can prevent leukocyte/platelet adhesion and further define the mechanisms whereby plasma proteins function as antiadhesive molecules.
20056908 Plasmin triggers chemotaxis of monocyte-derived dendritic cells through an Akt2-dependent pathway and promotes a T-helper type-1 response.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19850343 The pH-regulated antigen 1 (Pra1) protein was identified as a novel Factor H and FHL-1 binding protein.
19821587 Data have found that AMCHA binds at the canonical kringle lysine binding site (LBS), structured by the Pro54-Gly60 segment plus the neighboring Phe36, Thr37, Trp62, Leu71, and Tyr72 residues.
19801674 analysis of an exosite involved in catalytic turnover by the streptokinase-plasmin activator complex during human plasminogen activation
19800007 The NMR-derived structure of K2Pg in complex with VEK-30 presents a folding pattern typical of other kringle domains, while bound VEK-30 forms an end-to-end alpha-helix (residues 6-27) in the complex.
19712047 Proteolytic cleavage of HRG by plasmin may provide a feedback mechanism to regulate the effects of HRG on the plasminogen/plasmin system and other functions of HRG.
19574304 Acting as a human plasminogen receptor, the bifidobacterial surface enolase is suggested to play an important role in the interaction process with the host.
19465692 Angiostatin regulates the expression of antiangiogenic and proapoptotic pathways via targeted inhibition of mitochondrial proteins
19363026 Defining the structural basis of plasminogen binding by streptococcal surface enolase.
19308255 Borrelia recurrentis HcpA binds human complement regulators, Factor H, CFHR-1, and simultaneously, the host protease plasminogen.
19158842 bullous pemphigoid relevant collagen XVII fragment can also arise in an ADAM-independent manner through direct action by plasmin
19074676 Endostatin and angiostatin are increased in diabetic patients with coronary artery disease and associated with impaired coronary collateral formation.
18983515 ability of the apo(a) component of Lp(a) to inhibit the key positive feedback step of plasmin-mediated Glu-plasminogen to Lys-plasminogen conversion
18981180 Plasmin activates epithelial Na+ channels by cleaving the gamma subunit
18714035 closely related alpha(M)beta(2) ligands, plasminogen and angiostatin, derived from plasminogen, as well as fibrinogen and its two derivative alpha(M)beta(2) recognition peptides, P1 and P2-C, differed markedly in their effects on neutrophil apoptosis.
18685433 Direct interaction between human plasminogen and mouse hepatocytes occurs through its lysine binding sites. Kringle-number-dependent binding inhibition was seen,. Both high- & low-affinity sites participate in binding.
18667578 Recruitment of plasminogen on the bacterial cell surface provide B. lactis with plasmin effective in degradation of extracellular matrix.
18658146 analysis of the sequence of molecular events in the formation of the SK.Pm catalytic complex and its regulation by kringle ligands
18568768 Plasminogen derivatives encoding kringles 1-4 and kringles 1-5 exert indirect antiangiogenic and direct antitumoral effects in experimental lung cancer.
18566672 Directly binds to Aspergillus fumigatus; genetic variation within the plasminogen pathway influences the pathogenesis of invasive aspergillosis.
18566672 Observational study of gene-disease association. (HuGE Navigator)
18392331 results demonstrate that alteration of glycosylation and Lys binding properties could increase the anti-angiogenic action of krngle 1-5, possibly via enhanced interaction with integrin alpha(v)beta(3) in endothelial cells
18366077 Data suggest that PANC-1 cells possess intrinsic, PAI-1-sensitive mechanism for promotion of aggregation and differentiation by prolonged exposure to plasminogen and, possibly, additional precursors of PARs agonists.
18331597 SAK reduces tPA/uPA-mediated Plg activation by means of SAK.Plg complex formation, consequently downregulating tPA/uPA-induced fibrinolysis.
18329389 These findings demonstrate that Arg(484) plays a key role within the A2 plasmin-binding site, responsible for plasmin-catalyzed factor VIII(a) inactivation.[Plasmin]
18310038 The findings illustrate how apparently innocuous commensal bacteria are capable of utilizing a mechanism that is generally regarded as being of importance to pathogenicity and suggest an additional role of plasminogen binding.
18289715 We have recently identified increased expression of tPA genes that implicate fibrinolysis in ALD progression.
18279394 The modulation of plasmin activity by long-chain fatty acids was characterized quantitatively in a continuous amidolytic assay.
18223261 Alpha(2)-AP-resistant urinary plasmin activity may be useful as a diagnostic marker for acute poststreptococcal glomerulonephritis.
18163891 angiogenesis inhibition activity on endothelial cells caused by plasminogen processing by cathepsin V
18160581 Arginine stabilization allows reliable determinations of functional plasminogen in the blood of patients receiving fibrinolytics, enabling the rapid diagnosis of prothrombotic plasminogen consumption.
18070889 These results support the idea of a physiological role for the choline-binding protein E (CBPE)-plasminogen interaction in pneumococcal dissemination into human tissue.
18039838 Plasminogen was identified as the fourth host regulatory molecule in human serum that binds to A. fumigatus conidia.
17978577 The results of this study indicate that leukocytes regulate plasminogen activation, and consequently plasmin activities, through an interaction with alphaXbeta2 integrin.
17976375 Plasmin has nucleosome releasing factor (NRF) activity, but is not the NRF responsible for removal of nucleosomes from secondary necrotic cells.
17927806 A plasminogen gene SNP was associated with non-fatal myocardial infarction risk.
17890952 Hydroxyethyl starch (HES) dilution enhances fibrinolysis by diminishing alpha2-antiplasmin-plasmin interactions. Plasmin =plasminogen activated by limited proteolysis.
17656680 a novel role for the plasminogen activation system in the regulation of fibroblast apoptosis and a potential role of TGF-beta1/PAI-1 in promoting (myo)fibroblast survival in chronic fibrotic disorders.
17653767 Leishmania mexicana enolase acts as a possible plasminogen receptor in vivo.
17616171 the explosive generation of plasmin in blood or plasma, which diminishes SK's therapeutic effects, is attributable to the formation of SK x Pg*, and this process is governed by kringle domains.
17606760 endothelial microparticles act as vectors supporting efficient plasmin generation
17545513 stromal fibroblasts play a role in promoting pancreatic cancer metastasis via activation of the uPA-plasminogen-MMP-2 cascade
17379720 Strain ST1 of L. crispatus enhanced activation of human Plg by the tissue-type Plg activator (tPA), whereas enhancement of the urokinase-mediated Plg activation was lower.
17272502 Kringle 5 of human plasminogen has a role in autophagic survival by up-regulating Beclin 1 and complexing Bcl-2 to Beclin 1
17206383 Plasminogen bound to hsps 27, 60, and 70 and Angiostatin predominantly bound to hsp 27 and to hsp 70 in a concentration- and kringle-dependent manner.
17200769 Ca (2+) -dependent and -independent binding of Lys-Pg to FXa33/13 are C-terminal lysine-dependent. The N-terminal 1 - 77 amino acids of Glu-Pg confer significant C-terminal lysine-independent binding, which may play a role in PLG activation
17115186 Observational study of gene-disease association. (HuGE Navigator)
16828203 Observational study of gene-disease association. (HuGE Navigator)
16790522 propose that the human plasminogen system plays a critical role in group A streptococcal M1T1 systemic disease initiation.
16601838 angiostatins K1-3, K1-4 and K1-4.5 mediate anti-angiogenesis in a process involvingp53, FasL, AKT and mRNA deregulation
16478887 The cytoprotective effect of plasminogen requires plasmin proteolytic activity and requires PAR1
16229836 Protein S plays a role in cell-associated plasminogen activation and invasive potential of inflammatory cells.
16097950 The effect of conformation on the initial and secondary cleavages of plasminogen to generate active angiostatins is reported.
16087677 Plasmin and thrombin accelerate shedding of syndecan-4 ectodomain, which generates cleavage sites at Lys(114)-Arg(115) and Lys(129)-Val(130) bonds
15911629 associations suggest that PLG has the potential to simultaneously regulate calcium signaling pathways and Na+/H+ exchanges necessary for tumor cell proliferation and invasiveness
15746964 angiostatin and plasminogen share binding to endothelial cell surface actin and, therefore, that angiostatin has the potential to inhibit plasmin-dependent processes such as cell migration-movement
15677446 Data show that bacillolysin MA (BL-MA)affects blood coagulation and fibrinolysis systems and can be used to produce angiostatin-like plasminogen fragments and active serine proteases of human plasma [BL-MA].
15642732 plasminogen binds with high affinity to IGF-II and IGF-binding protein-3
15613921 histidine-proline-rich glycoprotein can act as either a positive or negative effector of Plg activation in vitro
15609351 recombinant PrPc binds to human plasminogen
15529749 studies of a 1:1 complex formed by the cellular conformation of the sheep prion protein with human plasminogen; effects of pressure, temperature and presence/absence of proteolytic inhibitors
15501816 binds to Streptococcus mutans alpha-enolase
15333838 a transgene expressing human plasminogen markedly increased mortality in mice infected with group A streptococci, and this susceptibility was dependent on bacterial streptokinase expression
15321992 Plasminogen binding in the presence of the urokinase-type plasminogen activator (uPA) promoted the invasion of HeLa cells by Mycoplasma fermentans
15220341 Plasminogen is bound to the cell surface by histidine-rich glycoprotein
15215240 analysis of the kinetic mechanism in which SK binding and reversible conformational activation of plasminogen occur in a rapid equilibrium, multistep process
15211511 Lys-698 of human Pg plays a functional role in the so-called N-terminal insertion activation mechanism by streptokinase.
15099286 A deficiency of plasminogen reduces processing of beta-endorphin and alpha-melanocyte stimulating hormone, and interferes with normal brain function.
15090462 Plasminogen is an adhesive ligand for integrins alphaMbeta2 and alpha5beta1.
14769799 assembly of Plg and uPA on integrin alpha(M)beta(2) regulates Plm activity and, thereby, plays a crucial role in neutrophil-mediated thrombolysis
14739127 Early plasmin generation does not seem to play a role in the subsequent activation of other inflammatory pathways during human endotoxemia.
14719094 presence of angiostatin in ascitic and pleural effusions from cancer patients
14678821 Computer model of the interaction of human TFPI-2 Kunitz-type serine protease inhibitor with human plasmin [letter]
12876630 A new plasminogen intron F-14T>G mutation, which was found to reduce the acceptor splicing site prediction score, suggesting a role in reducing the amount of correct plasminogen mRNA.
12871329 plasmin converts cell-bound Glu-plasminogen to Lys-plasminogen and this enzyme is produced by activation of monocytoid plasminogen by endogenous monocytoid plasminogen activators to enhance plasminogen activation on the monocytoid cell surface
12736244 The voltage-dependent anion channel is a receptor for plasminogen kringle 5 on endothelial cells.
12700073 Evidence is reviewed for plasminogen binding in the tumor environment; the known intrinsic functional relationship between plasminogen conformation and activation is essentially connected to cellular binding.
12697748 investigation of the mechanism of inhibition of plasminogen activation by lipoprotein(a)
12692411 Observational study of gene-disease association. (HuGE Navigator)
12692411 Data suggest that dysplasminogenemia (congenital deficiency of plasminogen and molecular abnormality of plasminogen) may be a risk factor for deep vein thrombosis in the Korean population.
12646571 investigation of clotting role of Kringle-1 domain from human plasminogen
12406896 Angiostatin inhibited HGF-induced phosphorylation of c-met, Akt, and ERK1/2. Angiostatin also significantly inhibited proliferation of human umbilical vein endothelial cells (HUVECs) induced by HGF.
12192005 Data show that keratinocytes use an alternative plasminogen and matrix metalloproteinase-13-dependent pathway for dissolution of collagen fibrils.
12093796 plasmin induction of MCP-1 and CD40 in human monocytes via p38 MAPK and janus kinase/STAT signaling pathways
12080056 substrate specificity of micro-plasminogen
12036889 Tissue factor is the receptor for plasminogen type 1, containing both N-linked and O-linked oligosaccharide chains, on 1-LN human prostate cancer cells.
12016220 Streptokinase (SK) and staphylokinase activate human plasminogen
11888684 Angiostatin, an angiogenesis inhibitor, lowers intracellular pH in cultured endothelial cells under conditions of low extracellular pH, resulting in a decrease in cell migration and an increase in cell death.

AA Sequence

MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKE      1 - 70
QQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPA     71 - 140
THPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWD    141 - 210
SQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTG    211 - 280
ENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIP    281 - 350
SCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG    351 - 420
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYR    421 - 490
GKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC    491 - 560
AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRP    561 - 630
SSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECF    631 - 700
ITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKD    701 - 770
KYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN                                  771 - 810
//

Text Mined References (326)

PMID Year Title
26667841 2015 Network of Surface-Displayed Glycolytic Enzymes in Mycoplasma pneumoniae and Their Interactions with Human Plasminogen.
26637181 2015 Minor Role of Plasminogen in Complement Activation on Cell Surfaces.
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26359437 2015 Coagulation factor XIIIa is inactivated by plasmin.
26070561 2015 Direct Host Plasminogen Binding to Bacterial Surface M-protein in Pattern D Strains of Streptococcus pyogenes Is Required for Activation by Its Natural Coinherited SK2b Protein.
26067271 2015 A Novel Interaction between Complement Inhibitor C4b-binding Protein and Plasminogen That Enhances Plasminogen Activation.
26029848 2015 Preferential Acquisition and Activation of Plasminogen Glycoform II by PAM Positive Group A Streptococcal Isolates.
25993872 2015 [Changes in markers of proliferation, neoangiogenesis and plasminogen activation system in rectal cancer tissue].
25971850 2016 Role of tubulointerstitial plasmin in the progression of IgA nephropathy.
25789495 2015 Zinc delays clot lysis by attenuating plasminogen activation and plasmin-mediated fibrin degradation.
25712989 2015 Plasminogen associates with phosphatidylserine-exposing platelets and contributes to thrombus lysis under flow.
25556624 2015 Interplay between fibrinolysis and complement: plasmin cleavage of iC3b modulates immune responses.
25466412 2015 Genetic evidence for PLASMINOGEN as a shared genetic risk factor of coronary artery disease and periodontitis.
25409527 2014 Staphylococcus aureus manganese transport protein C (MntC) is an extracellular matrix- and plasminogen-binding protein.
25407528 2014 From plasminogen to plasmin: role of plasminogen receptors in human cancer.
25222106 2014 Fractal kinetic behavior of plasmin on the surface of fibrin meshwork.
25208887 2014 Genetic variants in PLG, LPA, and SIGLEC 14 as well as smoking contribute to plasma plasminogen levels.
25138220 2014 Rapid binding of plasminogen to streptokinase in a catalytic complex reveals a three-step mechanism.
25128532 2014 Reduced plasminogen binding and delayed activation render ?'-fibrin more resistant to lysis than ?A-fibrin.
25059665 2014 Binding of tissue-type plasminogen activator to the glucose-regulated protein 78 (GRP78) modulates plasminogen activation and promotes human neuroblastoma cell proliferation in vitro.
24909805 2014 Association of plasma fibrinogen and plasminogen with prognosis of inoperable chronic thromboembolic pulmonary hypertension.
24840471 2014 Proteomic analysis of the interaction of Bifidobacterium longum NCC2705 with the intestine cells Caco-2 and identification of plasminogen receptors.
24605649 [System of activation of plasminogen in Vibrio cholerae].
24457100 2014 Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration.
24449821 2014 Plasmin cleavage of von Willebrand factor as an emergency bypass for ADAMTS13 deficiency in thrombotic microangiopathy.
24338014 2014 Characterization of a reduced form of plasma plasminogen as the precursor for angiostatin formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24263861 2013 HCV NS3 protease enhances liver fibrosis via binding to and activating TGF-? type I receptor.
24205998 2014 The comparison of endogenous angiogenesis inhibitors in normotensive and preeclamptic placentas: an immunohistochemical study.
24029428 2014 Comprehensive genetic analysis of complement and coagulation genes in atypical hemolytic uremic syndrome.
23969887 2014 Plasmin(ogen) acquisition by group A Streptococcus protects against C3b-mediated neutrophil killing.
23912396 2013 Serum levels of angiogenic and anti-angiogenic factors: their prognostic relevance in locally advanced hepatocellular carcinoma.
23906818 2013 The interaction between bacterial enolase and plasminogen promotes adherence of Streptococcus pneumoniae to epithelial and endothelial cells.
23853591 2013 A key role for the urokinase plasminogen activator (uPA) in invasive Group A streptococcal infection.
23850366 2013 The Bfp60 surface adhesin is an extracellular matrix and plasminogen protein interacting in Bacteroides fragilis.
23721211 2013 Plasminogen-stimulated inflammatory cytokine production by airway smooth muscle cells is regulated by annexin A2.
23702659 2013 Plasmin promotes foam cell formation by increasing macrophage catabolism of aggregated low-density lipoprotein.
23699598 2013 Diabetes is associated with posttranslational modifications in plasminogen resulting in reduced plasmin generation and enzyme-specific activity.
23645683 2013 Proteolytic processing regulates placental growth factor activities.
23583624 Binding and activation of plasminogen at the surface of Fusobacterium necrophorum.
23576799 2013 Plasmin induces intercellular adhesion molecule 1 expression in human endothelial cells via nuclear factor-?B/mitogen-activated protein kinases-dependent pathways.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23481605 2013 Cooperative plasminogen recruitment to the surface of Streptococcus canis via M protein and enolase enhances bacterial survival.
23449787 2013 Plasmin-mediated activation of pandemic H1N1 influenza virus hemagglutinin is independent of the viral neuraminidase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23341464 2013 Streptococcus pneumoniae endopeptidase O (PepO) is a multifunctional plasminogen- and fibronectin-binding protein, facilitating evasion of innate immunity and invasion of host cells.
23335990 2013 The structure of human microplasmin in complex with textilinin-1, an aprotinin-like inhibitor from the Australian brown snake.
23150713 2012 Serum-derived plasminogen is activated by apoptotic cells and promotes their phagocytic clearance.
23140098 2013 Plasmin and the thrombin-thrombomodulin complex both contribute to thrombin-activatable fibrinolysis inhibitor activation in whole blood model thrombi.
23118497 2012 The serine protease plasmin triggers expression of the CC-chemokine ligand 20 in dendritic cells via Akt/NF-?B-dependent pathways.
23103380 2013 Identification of binding sites of Lactobacillus plantarum enolase involved in the interaction with human plasminogen.
23071827 2012 Staphylococcus aureus proteins Sbi and Efb recruit human plasmin to degrade complement C3 and C3b.
23071278 2012 Dihydrolipoamide dehydrogenase of Pseudomonas aeruginosa is a surface-exposed immune evasion protein that binds three members of the factor H family and plasminogen.
22996753 2013 Spontaneous metastasis in congenic mice with transgenic breast cancer is unaffected by plasminogen gene ablation.
22987920 2012 Urinary plasmin activates collecting duct ENaC current in preeclampsia.
22974122 2012 Regulation of fibrinolysis by C-terminal lysines operates through plasminogen and plasmin but not tissue-type plasminogen activator.
22832192 2012 The X-ray crystal structure of full-length human plasminogen.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
22732096 2012 Lsa30, a novel adhesin of Leptospira interrogans binds human plasminogen and the complement regulator C4bp.
22685231 2012 Binding of von Willebrand factor cleaving protease ADAMTS13 to Lys-plasmin(ogen).
22677171 2012 Alendronate promotes plasmin-mediated MMP-9 inactivation by exposing cryptic plasmin degradation sites within the MMP-9 catalytic domain.
22641690 2012 Confluence switch signaling regulates ECM composition and the plasmin proteolytic cascade in keratinocytes.
22619171 2012 Proteolytic cleavage of extracellular ?-synuclein by plasmin: implications for Parkinson disease.
22518846 2012 Streptococcus uberis plasminogen activator (SUPA) activates human plasminogen through novel species-specific and fibrin-targeted mechanisms.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22507544 2012 Fibrinogen counteracts the antiadhesive effect of fibrin-bound plasminogen by preventing its activation by adherent U937 monocytic cells.
22321644 2012 Pro42 and Val45 of staphylokinase modulate intermolecular interactions of His43-Tyr44 pair and specificity of staphylokinase-plasmin activator complex.
22287006 2012 Tumor necrosis factor alpha modulates the dynamics of the plasminogen-mediated early interaction between Bifidobacterium animalis subsp. lactis and human enterocytes.
22197896 2012 Homocysteine and its thiolactone impair plasmin activity induced by urokinase or streptokinase in vitro.
22187433 2012 A high affinity interaction of plasminogen with fibrin is not essential for efficient activation by tissue-type plasminogen activator.
22147698 2012 Calcium binding to leptospira outer membrane antigen LipL32 is not necessary for its interaction with plasma fibronectin, collagen type IV, and plasminogen.
22124123 2012 Haemophilus influenzae uses the surface protein E to acquire human plasminogen and to evade innate immunity.
22079981 2011 Dengue virus-induced autoantibodies bind to plasminogen and enhance its activation.
22027013 2012 Genetic analysis of genes involved in amyloid-? degradation and clearance in Alzheimer's disease.
21998162 2012 Blood-brain barrier invasion by Cryptococcus neoformans is enhanced by functional interactions with plasmin.
21900290 2012 Genetic variants, plasma lipoprotein(a) levels, and risk of cardiovascular morbidity and mortality among two prospective cohorts of type 2 diabetes.
21832858 2011 Potential role of serine proteases in modulating renal sodium transport in vivo.
21802507 2011 In vitro evidence for immune evasion activity by human plasmin associated to pathogenic Leptospira interrogans.
21787393 2011 Matrix metalloproteinase-19 inhibits growth of endothelial cells by generating angiostatin-like fragments from plasminogen.
21755014 2011 Characterization of novel OmpA-like protein of Leptospira interrogans that binds extracellular matrix molecules and plasminogen.
21680799 2011 Monoclonal antibodies detect receptor-induced binding sites in Glu-plasminogen.
21543325 2011 Contribution of conserved lysine residues in the alpha2-antiplasmin C terminus to plasmin binding and inhibition.
21510941 2011 Intermolecular interactions in staphylokinase-plasmin(ogen) bimolecular complex: function of His43 and Tyr44.
21467042 2011 Kinetics of activated thrombin-activatable fibrinolysis inhibitor (TAFIa)-catalyzed cleavage of C-terminal lysine residues of fibrin degradation products and removal of plasminogen-binding sites.
21464960 2011 Bacillus anthracis interacts with plasmin(ogen) to evade C3b-dependent innate immunity.
21316746 2011 Simultaneous thrombin and plasmin generation capacities in normal and abnormal states of coagulation and fibrinolysis in children and adults.
21300353 2011 Differential expression of oxidized/native lipoprotein(a) and plasminogen in human carotid and cerebral artery plaques.
21236472 2011 Degradation of cross-linked fibrin by leukocyte elastase as alternative pathway for plasmin-mediated fibrinolysis in sepsis-induced disseminated intravascular coagulation.
21174000 2011 Identification of three novel plasminogen (PLG) gene mutations in a series of 23 patients with low PLG activity.
21072208 2010 Contribution of plasminogen activation towards the pathogenic potential of oral streptococci.
20726765 2010 Activation of plasminogen by staphylokinase reduces the severity of Staphylococcus aureus systemic infection.
20709033 2010 Plasminogen and plasmin in Alzheimer's disease.
20702651 2010 Plasminogen promotes influenza A virus replication through an annexin 2-dependent pathway in the absence of neuraminidase.
20655859 2010 NMR backbone dynamics of VEK-30 bound to the human plasminogen kringle 2 domain.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20617841 2010 Human plasminogen kringle 3: solution structure, functional insights, phylogenetic landscape.
20565259 2010 Complement regulator-acquiring surface protein 1 of Borrelia burgdorferi binds to human bone morphogenic protein 2, several extracellular matrix proteins, and plasminogen.
20553606 2010 Secretion of extracellular hsp90alpha via exosomes increases cancer cell motility: a role for plasminogen activation.
20346413 2010 Naturally occurring human plasminogen, like genetically related apolipoprotein(a), contains oxidized phosphatidylcholine adducts.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20152941 2010 Effects on human plasminogen conformation and activation rate caused by interaction with VEK-30, a peptide derived from the group A streptococcal M-like protein (PAM).
20143645 2010 Treatment of episodes of hereditary angioedema with C1 inhibitor: serial assessment of observed abnormalities of the plasma bradykinin-forming pathway and fibrinolysis.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20112045 2010 The human alpha(2)-plasmin inhibitor: functional characterization of the unique plasmin(ogen)-binding region.
20095998 2010 Plasminogen on the surfaces of fibrin clots prevents adhesion of leukocytes and platelets.
20056908 2010 Plasmin triggers chemotaxis of monocyte-derived dendritic cells through an Akt2-dependent pathway and promotes a T-helper type-1 response.
20028034 2010 Residues essential for plasminogen binding by the cation-independent mannose 6-phosphate receptor.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19850343 2009 Immune evasion of the human pathogenic yeast Candida albicans: Pra1 is a Factor H, FHL-1 and plasminogen binding surface protein.
19821587 2009 Solution structure and functional characterization of human plasminogen kringle 5.
19801674 2009 Identification of a new exosite involved in catalytic turnover by the streptokinase-plasmin activator complex during human plasminogen activation.
19800007 2010 Solution structure of the complex of VEK-30 and plasminogen kringle 2.
19712047 2009 Regulation of histidine-rich glycoprotein (HRG) function via plasmin-mediated proteolytic cleavage.
19574304 2009 Bifidobacterial enolase, a cell surface receptor for human plasminogen involved in the interaction with the host.
19465692 2009 Angiostatin regulates the expression of antiangiogenic and proapoptotic pathways via targeted inhibition of mitochondrial proteins.
19363026 2009 Defining the structural basis of human plasminogen binding by streptococcal surface enolase.
19308255 2009 Borrelia recurrentis employs a novel multifunctional surface protein with anti-complement, anti-opsonic and invasive potential to escape innate immunity.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19158842 2009 Plasmin plays a role in the in vitro generation of the linear IgA dermatosis antigen LADB97.
19074676 2009 Endostatin and angiostatin are increased in diabetic patients with coronary artery disease and associated with impaired coronary collateral formation.
18983515 2008 Apolipoprotein(a) inhibits the conversion of Glu-plasminogen to Lys-plasminogen: a novel mechanism for lipoprotein(a)-mediated inhibition of plasminogen activation.
18981180 2008 Plasmin activates epithelial Na+ channels by cleaving the gamma subunit.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18714035 2008 Neutrophil apoptosis: selective regulation by different ligands of integrin alphaMbeta2.
18685433 2008 Binding of plasminogen to hepatocytes isolated from injured mouse liver and nonparenchymal-cell-dependent proliferation of hepatocytes.
18667578 2008 Plasminogen-dependent proteolytic activity in Bifidobacterium lactis.
18658146 2008 Rapid-reaction kinetic characterization of the pathway of streptokinase-plasmin catalytic complex formation.
18568768 2008 Plasminogen derivatives encoding kringles 1-4 and kringles 1-5 exert indirect antiangiogenic and direct antitumoral effects in experimental lung cancer.
18566672 2008 Plasminogen alleles influence susceptibility to invasive aspergillosis.
18392331 2008 Mutation of human plasminogen kringle 1-5 enhances anti-angiogenic action via increased interaction with integrin alpha(v)beta(3).
18366077 2008 Plasminogen-induced aggregation of PANC-1 cells requires conversion to plasmin and is inhibited by endogenous plasminogen activator inhibitor-1.
18331597 2008 Staphylokinase reduces plasmin formation by endogenous plasminogen activators.
18329389 2008 Identification of a plasmin-interactive site within the A2 domain of the factor VIII heavy chain.
18310038 2008 Plasminogen binding by oral streptococci from dental plaque and inflammatory lesions.
18289715 2008 Direct effects of alcohol on hepatic fibrinolytic balance: implications for alcoholic liver disease.
18279394 2008 Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acids. Identification of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation.
18223261 2008 Elevated urinary plasmin activity resistant to alpha2-antiplasmin in acute poststreptococcal glomerulonephritis.
18163891 2008 Cathepsin V, but not cathepsins L, B and K, may release angiostatin-like fragments from plasminogen.
18160581 Monitoring of functional plasminogen in the blood of patients on fibrinolytics.
18070889 2008 Streptococcus pneumoniae choline-binding protein E interaction with plasminogen/plasmin stimulates migration across the extracellular matrix.
18039838 2008 The opportunistic human pathogenic fungus Aspergillus fumigatus evades the host complement system.
17978577 2007 Identification of critical residues for plasminogen binding by the alphaX I-domain of the beta2 integrin, alphaXbeta2.
17976375 2007 A plasma nucleosome releasing factor (NRF) with serine protease activity is instrumental in removal of nucleosomes from secondary necrotic cells.
17927806 2008 Variation in 24 hemostatic genes and associations with non-fatal myocardial infarction and ischemic stroke.
17890952 2007 Hydroxyethyl starch enhances fibrinolysis in human plasma by diminishing alpha2-antiplasmin-plasmin interactions.
17656680 2008 Plasminogen activation induced pericellular fibronectin proteolysis promotes fibroblast apoptosis.
17653767 2007 Enolase as a plasminogen binding protein in Leishmania mexicana.
17616171 2007 Regulation of nonproteolytic active site formation in plasminogen.
17606760 2007 Activation of plasminogen into plasmin at the surface of endothelial microparticles: a mechanism that modulates angiogenic properties of endothelial progenitor cells in vitro.
17545513 2007 Interaction between cancer cells and stromal fibroblasts is required for activation of the uPAR-uPA-MMP-2 cascade in pancreatic cancer metastasis.
17379720 2007 Extracellular proteins of Lactobacillus crispatus enhance activation of human plasminogen.
17307854 2007 Cytosolic proteins contribute to surface plasminogen recruitment of Neisseria meningitidis.
17272502 2007 Kringle 5 of human plasminogen, an angiogenesis inhibitor, induces both autophagy and apoptotic death in endothelial cells.
17206383 2007 Plasminogen and angiostatin interact with heat shock proteins.
17203182 2007 Induction of alpha2-antiplasmin inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion.
17200769 2007 Plasminogen binds to plasmin-modulated factor Xa by Ca(2+) - and C-terminal lysine-dependent and -independent interactions.
17115186 2007 TagSNP evaluation for the association of 42 inflammation loci and vascular disease: evidence of IL6, FGB, ALOX5, NFKBIA, and IL4R loci effects.
16828203 2007 Association studies between the plasmin genes and late-onset Alzheimer's disease.
16790522 2006 Trigger for group A streptococcal M1T1 invasive disease.
16601838 2006 Anti-angiogenesis mediated by angiostatin K1-3, K1-4 and K1-4.5. Involvement of p53, FasL, AKT and mRNA deregulation.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16480936 2006 The role of beta2-glycoprotein I (beta2GPI) in the activation of plasminogen.
16478887 2006 Plasminogen inhibits TNFalpha-induced apoptosis in monocytes.
16319056 2006 Divergence in the plasminogen-binding group a streptococcal M protein family: functional conservation of binding site and potential role for immune selection of variants.
16229836 2005 Protein S attenuates the invasive potential of THP-1 cells by interfering with plasminogen binding on cell surface via a protein C-independent mechanism.
16097950 2005 Specific conformational changes of plasminogen induced by chloride ions, 6-aminohexanoic acid and benzamidine, but not the overall openness of plasminogen regulate, production of biologically active angiostatins.
16087677 2005 Plasmin- and thrombin-accelerated shedding of syndecan-4 ectodomain generates cleavage sites at Lys(114)-Arg(115) and Lys(129)-Val(130) bonds.
16043488 2005 Angiomotin regulates endothelial cell-cell junctions and cell motility.
15911629 2005 Association of plasminogen with dipeptidyl peptidase IV and Na+/H+ exchanger isoform NHE3 regulates invasion of human 1-LN prostate tumor cells.
15746964 2005 Angiostatin and plasminogen share binding to endothelial cell surface actin.
15677446 2005 Bacillolysin MA, a novel bacterial metalloproteinase that produces angiostatin-like fragments from plasminogen and activates protease zymogens in the coagulation and fibrinolysis systems.
15642732 2005 Interaction of insulin-like growth factor II (IGF-II) with multiple plasma proteins: high affinity binding of plasminogen to IGF-II and IGF-binding protein-3.
15613921 2004 Effects of histidine-proline-rich glycoprotein on plasminogen activation in solution and on surfaces.
15609351 2005 Binding of recombinant PrPc to human plasminogen: kinetic and thermodynamic study using a resonant mirror biosensor.
15529749 2004 Characterization of a complex formed between human plasminogen and recombinant sheep prion: pressure and thermal sensitivity of complex formation.
15501816 2004 Streptococcus mutans surface alpha-enolase binds salivary mucin MG2 and human plasminogen.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15333838 2004 Plasminogen is a critical host pathogenicity factor for group A streptococcal infection.
15321992 2004 Mycoplasma fermentans binds to and invades HeLa cells: involvement of plasminogen and urokinase.
15299951 1997 Structure of human plasminogen kringle 4 at 1.68 a and 277 K. A possible structural role of disordered residues.
15220341 2004 Plasminogen is tethered with high affinity to the cell surface by the plasma protein, histidine-rich glycoprotein.
15215240 2004 Resolution of conformational activation in the kinetic mechanism of plasminogen activation by streptokinase.
15211511 2004 Characterization of Lys-698-to-Met substitution in human plasminogen catalytic domain.
15207811 2004 The PDGF family: four gene products form five dimeric isoforms.
15099286 2004 Plasminogen regulates pro-opiomelanocortin processing.
15090462 2004 Characterization of plasminogen as an adhesive ligand for integrins alphaMbeta2 (Mac-1) and alpha5beta1 (VLA-5).
15016824 2004 Cell surface adenosine deaminase binds and stimulates plasminogen activation on 1-LN human prostate cancer cells.
14769799 2004 Integrin alphaMbeta2 orchestrates and accelerates plasminogen activation and fibrinolysis by neutrophils.
14764098 2004 Nonlysine-analog plasminogen modulators promote autoproteolytic generation of plasmin(ogen) fragments with angiostatin-like activity.
14739293 2004 Adhesion or plasmin regulates tyrosine phosphorylation of a novel membrane glycoprotein p80/gp140/CUB domain-containing protein 1 in epithelia.
14739127 2004 Inhibition of plasmin activity by tranexamic acid does not influence inflammatory pathways during human endotoxemia.
14726399 2004 Nicked beta2-glycoprotein I: a marker of cerebral infarct and a novel role in the negative feedback pathway of extrinsic fibrinolysis.
14719094 2004 Elevated levels of angiostatin in effusions from patients with malignant disease.
14699093 2004 Protease nexin-1 inhibits plasminogen activation-induced apoptosis of adherent cells.
14678821 2003 Computer model of the interaction of human TFPI-2 Kunitz-type serine protease inhibitor with human plasmin.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12876630 2003 Contraceptive pills induce an improvement in congenital hypoplasminogenemia in two unrelated patients with ligneous conjunctivitis.
12871329 2003 Endogenous plasmin converts Glu-plasminogen to Lys-plasminogen on the monocytoid cell surface.
12736244 2003 The voltage-dependent anion channel is a receptor for plasminogen kringle 5 on human endothelial cells.
12700073 2003 Plasminogen binding and cancer: promises and pitfalls.
12697748 2003 Inhibition of plasminogen activation by lipoprotein(a): critical domains in apolipoprotein(a) and mechanism of inhibition on fibrin and degraded fibrin surfaces.
12692411 2003 Detection of an Ala601Thr mutation of plasminogen gene in 3 out of 36 Korean patients with deep vein thrombosis.
12646571 2003 A fast-acting, modular-structured staphylokinase fusion with Kringle-1 from human plasminogen as the fibrin-targeting domain offers improved clot lysis efficacy.
12604689 2003 Selective tryptic cleavage at the tethered ligand site of the amino terminal domain of proteinase-activated receptor-2 in intact cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456874 2002 Effects of deletion of streptokinase residues 48-59 on plasminogen activation.
12406896 2003 Angiostatin selectively inhibits signaling by hepatocyte growth factor in endothelial and smooth muscle cells.
12228252 2002 Acyl-enzyme complexes between tissue-type plasminogen activator and neuroserpin are short-lived in vitro.
12192005 2002 Collagen dissolution by keratinocytes requires cell surface plasminogen activation and matrix metalloproteinase activity.
12189145 2002 Activation of human meprin-alpha in a cell culture model of colorectal cancer is triggered by the plasminogen-activating system.
12093796 2002 The serine protease plasmin triggers expression of MCP-1 and CD40 in human primary monocytes via activation of p38 MAPK and janus kinase (JAK)/STAT signaling pathways.
12080056 2002 Structural elements that govern the substrate specificity of the clot-dissolving enzyme plasmin.
12054798 2002 The X-ray crystallographic structure of the angiogenesis inhibitor angiostatin.
12036889 2002 Tissue factor is the receptor for plasminogen type 1 on 1-LN human prostate cancer cells.
11939791 2002 The p11 subunit of annexin II heterotetramer is regulated by basic carboxypeptidase.
11928826 2002 Apolipoprotein(a): structure-function relationship at the lysine-binding site and plasminogen activator cleavage site.
11888684 2000 Effects of microenvironmental extracellular pH and extracellular matrix proteins on angiostatin's activity and on intracellular pH.
11729324 2001 Regulation of cell survival by secreted proneurotrophins.
11371191 2001 Binding of plasminogen and tissue plasminogen activator to plasmin-modulated factor X and factor Xa.
11350170 2001 Structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group A Streptococcal surface protein.
11342539 2001 Proteolytic cleavage of chromogranin A (CgA) by plasmin. Selective liberation of a specific bioactive CgA fragment that regulates catecholamine release.
11263499 2000 Brain plasmin enhances APP alpha-cleavage and Abeta degradation and is reduced in Alzheimer's disease brains.
11257124 2001 Angiomotin: an angiostatin binding protein that regulates endothelial cell migration and tube formation.
11169399 2000 Surface expression of a glycolytic enzyme, alpha-enolase, recognized by autoantibodies in connective tissue disorders.
11113116 2001 A truncated plasminogen activator inhibitor-1 protein induces and inhibits angiostatin (kringles 1-3), a plasminogen cleavage product.
11100730 2000 Binding of disease-associated prion protein to plasminogen.
11027681 2001 Purification, cloning, and characterization of a profibrinolytic plasminogen-binding protein, TIP49a.
10978167 2000 Proteolysis of the exodomain of recombinant protease-activated receptors: prediction of receptor activation or inactivation by MALDI mass spectrometry.
10974350 2000 Plasminogen and tissue plasminogen activator interact with antithrombin III.
10964919 2000 Mutational analysis of affinity and selectivity of kringle-tetranectin interaction. Grafting novel kringle affinity ontp the trtranectin lectin scaffold.
10956663 2000 Spatial regulation and activity modulation of plasmin by high affinity binding to the G domain of the alpha 3 subunit of laminin-5.
10928473 2000 Plasminogen binding properties of macrophage inflammatory protein (MIP)-2alpha.
10889192 2000 Binding of the NG2 proteoglycan to kringle domains modulates the functional properties of angiostatin and plasmin(ogen).
10700393 2000 Disruption of interkringle disulfide bond of plasminogen kringle 1-3 changes the lysine binding capability of kringle 2, but not its antiangiogenic activity.
10656799 2000 Human plasminogen catalytic domain undergoes an unusual conformational change upon activation.
10625689 2000 Post-translational proteolytic processing of procollagen C-terminal proteinase enhancer releases a metalloproteinase inhibitor.
10604721 1999 Generation of angiostatin-like fragments from plasminogen by prostate-specific antigen.
10512713 1999 Cloning and characterization of hurpin (protease inhibitor 13): A new skin-specific, UV-repressible serine proteinase inhibitor of the ovalbumin serpin family.
10233898 1999 Compound-heterozygous mutations in the plasminogen gene predispose to the development of ligneous conjunctivitis.
10218588 1999 The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.
10215610 1999 Extrahepatic synthesis of plasminogen in the human cornea is up-regulated by interleukins-1alpha and -1beta.
10077593 1999 Angiostatin binds ATP synthase on the surface of human endothelial cells.
10069369 1999 Expression of plasminogen-related gene B varies among normal tissues and increases in cancer tissues.
9858247 1998 Plasminogen Kanagawa-I, a novel missense mutation, is caused by the amino acid substitution G732R.
9834305 1998 Therapy with a purified plasminogen concentrate in an infant with ligneous conjunctivitis and homozygous plasminogen deficiency.
9786936 1998 The plasminogen binding site of the C-type lectin tetranectin is located in the carbohydrate recognition domain, and binding is sensitive to both calcium and lysine.
9783753 1998 The ternary microplasmin-staphylokinase-microplasmin complex is a proteinase-cofactor-substrate complex in action.
9737862 1998 Identification of a meander region proline residue critical for heme binding to cytochrome P450: implications for the catalytic function of human CYP4B1.
9688635 1998 Plasminogen binds the heparin-binding domain of insulin-like growth factor-binding protein-3.
9596664 1998 Plasmin can reduce the function of human beta2 glycoprotein I by cleaving domain V into a nicked form.
9548733 1998 Generation of an angiostatin-like fragment from plasminogen by stromelysin-1 (MMP-3).
9521645 1998 Structure and ligand binding determinants of the recombinant kringle 5 domain of human plasminogen.
9490681 1998 Tissue factor regulates plasminogen binding and activation.
9428707 1997 High-molecular-mass and low-molecular-mass kininogens block plasmin-induced platelet aggregation by forming a complex with kringle 5 of plasminogen/plasmin.
9375744 1997 Ala601-Thr type dysplasminogenaemia genetically diagnosed in patients with retinochoroidal vascular disorders.
9360944 1997 Angiostatin-converting enzyme activities of human matrilysin (MMP-7) and gelatinase B/type IV collagenase (MMP-9).
9337997 1997 Proteolytic fragments of insulin-like growth factor binding protein-3: N-terminal sequences and relationships between structure and biological activity.
9305949 1997 Ligand preferences of kringle 2 and homologous domains of human plasminogen: canvassing weak, intermediate, and high-affinity binding sites by 1H-NMR.
9242524 1997 Homozygous mutations in the plasminogen gene of two unrelated girls with ligneous conjunctivitis.
9234243 1997 Degradation of C1-inhibitor by plasmin: implications for the control of inflammatory processes.
9201958 1997 Serine-578 is a major phosphorylation locus in human plasma plasminogen.
9102401 1997 Acceleration of plasminogen activation by tissue plasminogen activator on surface-bound histidine-proline-rich glycoprotein.
9102221 1997 A recombinant human angiostatin protein inhibits experimental primary and metastatic cancer.
9054441 1997 Evidence for a novel O-linked sialylated trisaccharide on Ser-248 of human plasminogen 2.
9020112 1997 Interactions of mast cell tryptase with thrombin receptors and PAR-2.
8910613 1996 Kringle domains of human angiostatin. Characterization of the anti-proliferative activity on endothelial cells.
8843739 1996 IGFBP-3 proteolysis by plasmin, thrombin, serum: heparin binding, IGF binding, and structure of fragments.
8652577 1996 Recombinant gene expression and 1H NMR characteristics of the kringle (2 + 3) supermodule: spectroscopic/functional individuality of plasminogen kringle domains.
8612605 1996 Motifs resembling hepatocyte nuclear factor 1 and activator protein 3 mediate the tissue specificity of the human plasminogen gene.
8611560 1996 Crystal structures of the recombinant kringle 1 domain of human plasminogen in complexes with the ligands epsilon-aminocaproic acid and trans-4-(aminomethyl)cyclohexane-1-carboxylic Acid.
8555184 1996 Inhibitory properties of a novel human Kunitz-type protease inhibitor homologous to tissue factor pathway inhibitor.
8478593 1993 Familial association of high levels of histidine-rich glycoprotein and plasminogen activator inhibitor-1 with venous thromboembolism.
8460120 1993 Identification of a region of beta 2-glycoprotein I critical for lipid binding and anti-cardiolipin antibody cofactor activity.
8392398 1993 Congenital plasminogen deficiency caused by a Ser572 to Pro mutation.
8360181 1993 The extracellular matrix proteins laminin and fibronectin contain binding domains for human plasminogen and tissue plasminogen activator.
8181476 1994 Solution structure of the epsilon-aminohexanoic acid complex of human plasminogen kringle 1.
8181475 1994 1H-NMR assignments and secondary structure of human plasminogen kringle 1.
8162705 1994 Subregional mapping of 8 single copy loci to chromosome 6 by fluorescence in situ hybridization.
8054447 1994 The structure of recombinant plasminogen kringle 1 and the fibrin binding site.
7982919 1994 Osteonectin in matrix remodeling. A plasminogen-osteonectin-collagen complex.
7814888 1995 Complement component C7 is a plasminogen-binding protein.
7586586 1995 Interaction of human pregnancy-associated plasma protein-A with serine proteinases.
7548163 1995 Production and characterization of recombinant human proteinase inhibitor 6 expressed in Pichia pastoris.
7538844 1994 Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.
7525077 1994 Angiostatin: a novel angiogenesis inhibitor that mediates the suppression of metastases by a Lewis lung carcinoma.
6980881 1982 Proteolytic cleavage and inactivation of alpha 2-plasmin inhibitor and C1 inactivator by human polymorphonuclear leukocyte elastase.
6919539 1982 Structure of the omega-aminocarboxylic acid-binding sites of human plasminogen. Arginine 70 and aspartic acid 56 are essential for binding of ligand by kringle 4.
6838832 1983 Amino acid sequence analysis of the asparagine-288 region of the carbohydrate variants of human plasminogen.
6582496 1984 Single-chain structure of human ceruloplasmin: the complete amino acid sequence of the whole molecule.
6438154 1984 Complex formation of platelet thrombospondin with plasminogen. Modulation of activation by tissue activator.
6238949 1984 Plasminogens Tochigi II and Nagoya: two additional molecular defects with Ala-600----Thr replacement found in plasmin light chain variants.
6216475 1982 Plasminogen Tochigi: inactive plasmin resulting from replacement of alanine-600 by threonine in the active site.
6148961 1984 Characterization of a complementary deoxyribonucleic acid coding for human and bovine plasminogen.
6094526 1984 The fibrin-binding site of human plasminogen. Arginines 32 and 34 are essential for fibrin affinity of the kringle 1 domain.
5475635 1970 Plasminogen: purification from human plasma by affinity chromatography.
4694729 1973 The primary structure of human plasminogen. II. The histidine loop of human plasmin: light (B) chain active center histidine sequence.
4240117 1969 Studies on the active center of human plasmin. Partial amino acid sequence of a peptide containing the active center serine residue.
4226004 1967 The peptide chains of human plasmin. Mechanism of activation of human plasminogen to plasmin.
3920216 1985 Binding and activation of plasminogen on the platelet surface.
3356193 1988 The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns.
3334852 1988 Binding site of alpha 2-plasmin inhibitor to plasminogen.
3030813 1987 Molecular cloning and characterization of a full-length cDNA clone for human plasminogen.
2962641 1987 Interaction of one-chain and two-chain tissue plasminogen activator with intact and plasmin-degraded fibrin.
2962191 1987 Structure and formation of microplasmin.
2829380 1987 Receptor mediated binding of the fibrinolytic components, plasminogen and urokinase, to peripheral blood cells.
2745554 1989 SPARC, a secreted protein associated with cellular proliferation, inhibits cell spreading in vitro and exhibits Ca+2-dependent binding to the extracellular matrix.
2522013 1989 Thrombospondin interaction with plasminogen. Evidence for binding to a specific region of the kringle structure of plasminogen.
2437112 1987 The reactive site of human alpha 2-antiplasmin.
2318848 1990 Characterization of the gene for human plasminogen, a key proenzyme in the fibrinolytic system.
2157850 1990 Solution structure of the kringle 4 domain from human plasminogen by 1H nuclear magnetic resonance spectroscopy and distance geometry.
2143188 1990 A unique proteolytic fragment of human fibrinogen containing the A alpha COOH-terminal domain of the native molecule.
2065054 1991 Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503).
1986355 1991 Two types of abnormal genes for plasminogen in families with a predisposition for thrombosis.
1939207 1991 Isolation, molecular cloning, and partial characterization of a novel carboxypeptidase B from human plasma.
1909331 1991 Interactions of plasminogen and tissue plasminogen activator (t-PA) with amphoterin. Enhancement of t-PA-catalyzed plasminogen activation by amphoterin.
1657149 1991 The refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle 4.
1657148 1991 Crystal and molecular structure of human plasminogen kringle 4 refined at 1.9-A resolution.
1427790 Plasminogen with type-I mutation is polymorphic in the Japanese population.
659588 1978 Abnormal plasminogen. A hereditary molecular abnormality found in a patient with recurrent thrombosis.
479158 1979 Carbohydrate of the human plasminogen variants. III. Structure of the O-glycosidically linked oligosaccharide unit.
158022 1979 On the mechanism of the reaction between human alpha 2-antiplasmin and plasmin.
146197 1977 Chemical evidence that proteolytic cleavage causes the heterogeneity present in human ceruloplasmin preparations.
142009 1977 Primary structure of the B-chain of human plasmin.
134998 1976 Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis.
126863 1975 Amino-acid sequence of the cyanogen-bromide fragment from human plasminogen that forms the linkage between the plasmin chains.
122932 1975 Structural relationship between "glutamic acid" and "lysine" forms of human plasminogen and their interaction with the NH2-terminal activation peptide as studied by affinity chromatography.