Property Summary

NCBI Gene PubMed Count 2
PubMed Score 9.75
PubTator Score 2.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 2.8e-05

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 2.8e-05

Gene RIF (1)

AA Sequence

MAVFHDMLLQPLGMFLCLSLQLSSATFIRYSSTCFTFDEYYTITLDIKASSHIYESNAVYSVFVPVNDSV      1 - 70
YAVVMKTLDENSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQAFTVQIRALPI     71 - 140
LSTLKLREKLSTLALAAKIPQSSAFKPFFMITPKSIRLEGLANQVFSSPITEAIYILLAFLTSTLLF       141 - 207
//

Text Mined References (3)

PMID Year Title