Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.18
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREE      1 - 70
PGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEA     71 - 140
RFQLSGLQA                                                                 141 - 149
//

Text Mined References (9)

PMID Year Title