Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.66
PubTator Score 5.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer -1.100 3.6e-04
Waldenstrons macroglobulinemia -1.573 2.2e-02
posterior fossa group B ependymoma 2.000 7.4e-10
astrocytoma 1.100 2.1e-15
glioblastoma 1.300 5.9e-05
osteosarcoma 1.303 2.8e-04
group 4 medulloblastoma 1.500 9.0e-04
medulloblastoma, large-cell 1.400 3.1e-02
sarcoidosis 1.300 1.4e-02
breast carcinoma 1.300 7.3e-17
Breast cancer 4.000 4.9e-02
pediatric high grade glioma 1.300 7.5e-06
pilocytic astrocytoma 1.600 5.5e-06
primary Sjogren syndrome 1.200 3.4e-03
pancreatic carcinoma -1.100 3.6e-04
ductal carcinoma in situ 1.600 7.2e-04
invasive ductal carcinoma 2.700 7.9e-04
ovarian cancer 1.200 6.2e-04

Gene RIF (4)

PMID Text
24416124 These findings establish that lysosomal accumulation of Akt and Phafin2 is a critical step in the induction of autophagy via an interaction with phosphatidylinositol 3 phosphate.
22816767 Phafin2 controls EGFR trafficking through early endosomes by facilitating endosome fusion in concert with EEA1.
19995552 These results provide a vivid example that an endosome modulator, such as Phafin2, may control the cells' responses to the extracellular cues.
18288467 Results demonstrate that EAPF/Phafin-2 facilitates TNF-alpha-induced cellular apoptosis through an ER-mitochondrial apoptotic pathway.

AA Sequence

MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQ      1 - 70
KKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKT     71 - 140
PSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDL    141 - 210
LSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSSD                                   211 - 249
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24416124 2014 Lysosomal interaction of Akt with Phafin2: a critical step in the induction of autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22816767 2012 The PtdIns3P-binding protein Phafin 2 mediates epidermal growth factor receptor degradation by promoting endosome fusion.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19995552 2010 Phafin2 modulates the structure and function of endosomes by a Rab5-dependent mechanism.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18288467 2008 EAPF/Phafin-2, a novel endoplasmic reticulum-associated protein, facilitates TNF-alpha-triggered cellular apoptosis through endoplasmic reticulum-mitochondrial apoptotic pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.