Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.66
PubTator Score 5.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.100 2.1e-15
Astrocytoma, Pilocytic 1.600 5.4e-06
Breast cancer 3.100 2.9e-02
breast carcinoma 1.200 1.4e-03
ductal carcinoma in situ 1.200 2.9e-03
ependymoma 1.400 2.6e-02
glioblastoma 1.200 8.8e-03
group 4 medulloblastoma 1.500 9.0e-04
invasive ductal carcinoma 2.100 2.2e-03
medulloblastoma, large-cell 1.400 3.1e-02
osteosarcoma 1.303 2.8e-04
ovarian cancer 1.200 6.2e-04
pancreatic cancer -1.100 3.6e-04
pancreatic carcinoma -1.100 3.6e-04
pediatric high grade glioma 1.300 7.5e-06
primary Sjogren syndrome 1.200 3.4e-03
sarcoidosis 1.300 1.4e-02
Waldenstrons macroglobulinemia -1.573 2.2e-02

Gene RIF (5)

AA Sequence

MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQ      1 - 70
KKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKT     71 - 140
PSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDL    141 - 210
LSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSSD                                   211 - 249
//

Text Mined References (28)

PMID Year Title