Property Summary

NCBI Gene PubMed Count 9
PubMed Score 65.99
PubTator Score 4.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
breast carcinoma 1638 6.4e-06
Disease Target Count Z-score Confidence
Hydronephrosis 89 4.353 2.2
Vesicoureteral reflux 32 3.796 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma -1.400 6.4e-06

Gene RIF (2)

AA Sequence

MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLN      1 - 70
KRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQEWISHIEECVRRQLRATGRP     71 - 140
PSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYRE    141 - 210
LAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS     211 - 279
//

Text Mined References (9)

PMID Year Title